KEGG   Lactobacillus casei LC2W: LC2W_0992Help
Entry
LC2W_0992         CDS       T01956                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lce  Lactobacillus casei LC2W
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:lce00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:lce00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
968389..968862
Genome map
AA seq 157 aa AA seqDB search
MSIYDYEVTLEDGSQYALSKYKGRPMLIVNTATKCGFAPQFDGLEKLYDKFKDQGLVVLG
FPSDQFKQELADGHAAAEACRLKYGVSFPMHDLIKVNGKEAAPLFQYLKTQAPGELGKSI
KWNFTKFLVDRDGQVVARFAPKTKPEAIEPAVEKLLG
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatttatgattatgaggtcacattagaagatggctcgcaatatgctttgagcaaa
tacaagggtcgaccaatgttgatcgtgaacactgccactaaatgcggcttcgcgcctcag
tttgatggtttggagaaattgtatgacaagttcaaggatcaaggtttggtagtgctaggt
tttccttctgatcaatttaaacaggaactggctgatggtcatgcagcggccgaggcttgc
cggttgaaatacggtgtgagttttccaatgcatgatttgattaaggtgaacggcaaagaa
gcagctccgctgtttcaataccttaaaacccaagcccctggtgaactaggcaagtccatc
aaatggaactttacgaagtttttggttgatcgtgatggtcaagttgtcgcccgctttgca
ccaaaaacaaaaccagaagcgattgaaccagcagtggagaagcttcttggctaa

DBGET integrated database retrieval system