KEGG   Lactobacillus casei LC2W: LC2W_1119Help
Entry
LC2W_1119         CDS       T01956                                 

Gene name
tpiA
Definition
(RefSeq) phosphoglycerate kinase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lce  Lactobacillus casei LC2W
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LC2W_1119 (tpiA)
   01230 Biosynthesis of amino acids
    LC2W_1119 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LC2W_1119 (tpiA)
   00051 Fructose and mannose metabolism
    LC2W_1119 (tpiA)
   00562 Inositol phosphate metabolism
    LC2W_1119 (tpiA)
Enzymes [BR:lce01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LC2W_1119 (tpiA)
Exosome [BR:lce04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LC2W_1119 (tpiA)
  Exosomal proteins of bladder cancer cells
   LC2W_1119 (tpiA)
  Exosomal proteins of melanoma cells
   LC2W_1119 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
1084600..1085355
Genome map
AA seq 251 aa AA seqDB search
MRTPFIAGNWKMNKNPKETQEFLDGVKGKLPDASKVETVIGAPAIDLTTLVAGAEGTPLK
TAAENCYFEDEGAFTGETSPKALKEMNVDYVIIGHSERRGYFHETDEDINKKAKAIFKNN
LLPIICCGESLAQREAGQTEDWVASQIEAALAGLSADQVKVSVLAYEPIWAIGTGKTATA
DQAQEVVAHIRATVEKLYNKDTADAVRILYGGSVKPANVKELMAKPDIDGGLVGGASMDP
ESFIALANYQD
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacaccattcattgctggtaactggaaaatgaacaaaaatcctaaggaaacgcaa
gaattcttagacggcgttaaaggcaagttgcctgatgcaagcaaggttgagactgtcatt
ggtgcacctgccattgatttgaccaccttagttgctggcgctgaaggcacacctttgaag
acggcggctgaaaactgctactttgaagacgaaggtgccttcactggtgaaaccagcccg
aaagctttgaaagaaatgaacgttgattacgtcattatcggtcacagcgaacgtcgcggc
tatttccacgaaaccgatgaagatatcaataagaaggctaaggccatctttaagaacaat
cttttgccaatcatttgctgtggcgaaagtttggctcagcgcgaagctggccaaaccgaa
gactgggttgcttcacagattgaagctgctttggccggtttaagtgctgaccaagtcaaa
gtttcagtcttagcctatgaaccaatctgggctatcgggacaggtaagacggcaactgcc
gatcaggcacaagaagttgtcgcacatattcgtgcaacggttgagaagttgtataataaa
gatacggcagatgctgttcgtattctttacggcggctctgttaaaccagcgaacgtcaag
gaattaatggctaagcctgatatcgatggcggcttagtcggtggcgcttcgatggatcct
gaaagtttcatcgccttggctaactaccaagattaa

DBGET integrated database retrieval system