KEGG   Lactobacillus casei LC2W: LC2W_1119Help
Entry
LC2W_1119         CDS       T01956                                 

Gene name
tpiA
Definition
(GenBank) Phosphoglycerate kinase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lce  Lactobacillus casei LC2W
Pathway
lce00010  Glycolysis / Gluconeogenesis
lce00051  Fructose and mannose metabolism
lce00562  Inositol phosphate metabolism
lce01100  Metabolic pathways
lce01110  Biosynthesis of secondary metabolites
lce01120  Microbial metabolism in diverse environments
lce01130  Biosynthesis of antibiotics
lce01200  Carbon metabolism
lce01230  Biosynthesis of amino acids
Module
lce_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lce_M00002  Glycolysis, core module involving three-carbon compounds
lce_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LC2W_1119 (tpiA)
   00051 Fructose and mannose metabolism
    LC2W_1119 (tpiA)
   00562 Inositol phosphate metabolism
    LC2W_1119 (tpiA)
Enzymes [BR:lce01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LC2W_1119 (tpiA)
Exosome [BR:lce04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LC2W_1119 (tpiA)
  Exosomal proteins of bladder cancer cells
   LC2W_1119 (tpiA)
  Exosomal proteins of melanoma cells
   LC2W_1119 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEA53453
Position
1084600..1085355
Genome map
AA seq 251 aa AA seqDB search
MRTPFIAGNWKMNKNPKETQEFLDGVKGKLPDASKVETVIGAPAIDLTTLVAGAEGTPLK
TAAENCYFEDEGAFTGETSPKALKEMNVDYVIIGHSERRGYFHETDEDINKKAKAIFKNN
LLPIICCGESLAQREAGQTEDWVASQIEAALAGLSADQVKVSVLAYEPIWAIGTGKTATA
DQAQEVVAHIRATVEKLYNKDTADAVRILYGGSVKPANVKELMAKPDIDGGLVGGASMDP
ESFIALANYQD
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacaccattcattgctggtaactggaaaatgaacaaaaatcctaaggaaacgcaa
gaattcttagacggcgttaaaggcaagttgcctgatgcaagcaaggttgagactgtcatt
ggtgcacctgccattgatttgaccaccttagttgctggcgctgaaggcacacctttgaag
acggcggctgaaaactgctactttgaagacgaaggtgccttcactggtgaaaccagcccg
aaagctttgaaagaaatgaacgttgattacgtcattatcggtcacagcgaacgtcgcggc
tatttccacgaaaccgatgaagatatcaataagaaggctaaggccatctttaagaacaat
cttttgccaatcatttgctgtggcgaaagtttggctcagcgcgaagctggccaaaccgaa
gactgggttgcttcacagattgaagctgctttggccggtttaagtgctgaccaagtcaaa
gtttcagtcttagcctatgaaccaatctgggctatcgggacaggtaagacggcaactgcc
gatcaggcacaagaagttgtcgcacatattcgtgcaacggttgagaagttgtataataaa
gatacggcagatgctgttcgtattctttacggcggctctgttaaaccagcgaacgtcaag
gaattaatggctaagcctgatatcgatggcggcttagtcggtggcgcttcgatggatcct
gaaagtttcatcgccttggctaactaccaagattaa

DBGET integrated database retrieval system