KEGG   Lactobacillus casei LC2W: LC2W_1125Help
Entry
LC2W_1125         CDS       T01956                                 

Definition
phospholipid/glycerol acyltransferase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lce  Lactobacillus casei LC2W
Brite
Enzymes [BR:lce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     LC2W_1125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1090987..1091721
Genome map
AA seq 244 aa AA seqDB search
MIFREPQPFEYEGTDTGVVLLHAYTGSPNDMNFMGRALQRAGYGVYAPLFTGHGTIEPMD
ILTKGNPDIWWAEASAAVSHMTAKYDRVFVFGLSLGGIFAMKALEILPGVTAGGVFSSPI
LPGKHHLVPGFLKYAQYMNRLAGVPDESTQILAYLPGQLAAIDNFATGVAADLYLVNKPI
FIGQAGADELVDGQLAYQLRDALINAPQVDFHWYDNAKHVITVNSAHHALQQDVVAFMQQ
ENEG
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgatctttcgtgaaccgcaaccattcgaatacgagggcactgataccggtgttgttttg
ctgcatgcctatactggcagcccaaacgacatgaacttcatggggcgggccttgcagcgg
gctgggtatggcgtgtatgcgccgttgttcacgggacatggtaccattgagccaatggat
attctgactaagggcaacccagatatttggtgggcagaggccagcgcggctgtttcgcat
atgacagcaaagtatgaccgtgtttttgttttcggattatcactcggcggtattttcgcc
atgaaagctttggaaatattacccggtgtcacagctggcggcgttttttcatcgccgatc
ttaccgggtaagcaccatctcgtgccagggtttctgaaatacgcacaatatatgaatcgt
ttggcaggtgtaccagacgaaagtactcagattttggcttacttaccaggccagctggcg
gcgattgacaatttcgccactggggttgccgctgatctgtatttagttaataagccgatt
tttatcggccaagccggtgctgatgaattagttgatgggcagctggcctatcagctacgg
gatgcactcatcaatgcaccgcaagtagattttcattggtatgacaatgccaagcatgtg
atcaccgtgaattcggcgcatcacgcactacaacaagacgttgtcgcatttatgcaacaa
gaaaacgagggatag

DBGET integrated database retrieval system