KEGG   Lactobacillus casei LC2W: LC2W_1212Help
Entry
LC2W_1212         CDS       T01956                                 

Definition
Acyl-CoA thioesterase family protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
lce  Lactobacillus casei LC2W
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:lce00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    LC2W_1212
Enzymes [BR:lce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     LC2W_1212
   3.1.2  Thioester hydrolases
    3.1.2.-  
     LC2W_1212
Lipid biosynthesis proteins [BR:lce01004]
 Fatty acid synthase
  Component type
   LC2W_1212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1171171..1171962)
Genome map
AA seq 263 aa AA seqDB search
MKKFWLGFGLLLLILAAGCEVQHKAAKSSSSAASLRSRKSPSSRSSAAIKQTSMLARLKA
KSQTTLVYAPFGDSLSVGLFADSKTSRFTTLFADQLHHLTDKTVTEEGIAEVGKTATNLG
VPALPALIAQHPDLITIEFGTNDAVGGATPTALADYRQALTTIVATLQKQTTAELILMTT
WSPNHGPYAAADLQFDAVVKQIGQTYHVPVADLATIWQNHDDVTGPAGTAITDFAGNGPR
DTFHPNQRGHDQIAALLKKTLEE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagttttggttgggttttggtcttttattgctcattttagcggctggctgcgag
gttcaacacaaggcggctaaatcgagcagttcagcggcttcgcttcgcagccgcaagtcg
cctagttcgcgatcctcagctgcgattaagcagacaagcatgctcgcccggctgaaggca
aaatcacaaacgacgctcgtgtatgcaccgtttggcgacagcctctctgttggtttgttt
gcggatagtaaaacaagccggtttaccaccctttttgctgaccaattacaccatttgact
gacaagacggtgacagaggaagggattgcagaggtgggaaaaaccgcgactaatcttggt
gtccctgctctgccagcgttgattgcccagcatcctgatttgattaccatcgagtttggg
acgaacgatgcggttggcggcgccacaccaacggcgctggctgattaccgccaggcgttg
acaaccatcgtggcaaccttgcagaagcaaacaacagctgagttgatccttatgacgacc
tggtcgccaaaccatggtccttatgccgccgccgatttgcaatttgatgctgtggtcaaa
caaatcggtcaaacttatcacgttccagttgccgatctggcgaccatctggcaaaaccat
gatgacgtcacaggccctgccggtacagccatcaccgacttcgctggtaacggtccgcgc
gatacttttcaccccaaccagcgcggtcatgatcagattgctgccttgctcaagaaaact
ttggaggaataa

DBGET integrated database retrieval system