KEGG   Lactobacillus casei LC2W: LC2W_1256Help
Entry
LC2W_1256         CDS       T01956                                 

Gene name
gtaB
Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lce  Lactobacillus casei LC2W
Pathway
lce00040  Pentose and glucuronate interconversions
lce00052  Galactose metabolism
lce00500  Starch and sucrose metabolism
lce00520  Amino sugar and nucleotide sugar metabolism
lce01100  Metabolic pathways
lce01130  Biosynthesis of antibiotics
Module
lce_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lce00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LC2W_1256 (gtaB)
   00052 Galactose metabolism
    LC2W_1256 (gtaB)
   00500 Starch and sucrose metabolism
    LC2W_1256 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    LC2W_1256 (gtaB)
Enzymes [BR:lce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LC2W_1256 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD
Motif
Other DBs
NCBI-ProteinID: AEA53590
Position
1213878..1214792
Genome map
AA seq 304 aa AA seqDB search
MKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEAKASGIEDILIVEGKQK
RSIEDHFDSAPELEQNLKEKHKDALLELVHSTTDIGVNLFFVRQPYPRGLGDAVRLAKSF
VGDEPFVVMLGDDLMHDKVPLTKQLINEYDKTHASILAVKKVPHDEVSAYGVIDPEKEVS
KGLFNVKKFVEKPAVADAPSDLAIIGRYLLTPEIFDILENQKPGKGNEIQLTDAIDTLNQ
TQRVFAHEFTGDRYDVGNKFGYVKTNIEYGLTHPEVKDELRAYILDLASKLQANKPVGKP
ANKK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagttcgtaaggcagtcattccggcagccgggcttgggacccgctttctgccagca
actaaagctttagccaaagagatgttaccaatcgttgataaaccaaccattcagttcatc
gttgaagaggctaaggccagcgggattgaagacattctgatcgttgagggtaaacaaaaa
cgttctattgaggaccatttcgattctgctcctgaattggaacagaatttgaaagaaaaa
cataaagatgccttgttggagttggttcactccactactgacatcggcgttaatctcttc
ttcgttcgccagccatatccgcgcggccttggggatgccgttcgtttggcgaagtcattc
gttggcgacgaaccatttgttgtcatgctcggcgatgacctgatgcatgacaaggtaccg
ttgaccaagcaactgattaacgaatacgataagacccacgcatccattcttgctgttaaa
aaagtgccacatgacgaagtttcagcttatggcgttattgaccctgaaaaagaagtttca
aagggactcttcaacgtcaagaaatttgttgaaaagccagctgttgccgatgcaccaagt
gacttggccatcattggtcgttacttgttgacaccagagatctttgatattctcgaaaat
caaaaacctggtaagggtaacgaaattcaactcaccgatgccatcgacaccttgaaccaa
acccagcgtgtcttcgcccatgaattcaccggagatcgttatgacgttgggaataagttt
ggctatgtgaagaccaacatcgagtatggcttgacccatccagaagtgaaggatgagctg
cgtgcttatattcttgacttggcttcaaagctacaggcaaataagcctgtggggaagccg
gcaaataagaagtaa

DBGET integrated database retrieval system