KEGG   Lactobacillus casei LC2W: LC2W_1267Help
Entry
LC2W_1267         CDS       T01956                                 

Definition
hypothetical protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lce  Lactobacillus casei LC2W
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LC2W_1267
Enzymes [BR:lce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LC2W_1267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1223180..1224628)
Genome map
AA seq 482 aa AA seqDB search
MTNQQFPENFLWGGATAANQLEGAYQTDGKGLSTSDLLLGGNVNTPRKTTRELVPDAFYP
SHEAIDHFHRFKEDIALFAEMGFKLYRFSIAWTRIFPTGLETEPNEAGLAFYDQIIAELK
RYNIEPLITISHFESPIGLTKAFNGWAARDMIAAYVRFAKVIINRYHHDVKYWLTFNEIN
MLTRPMGAYLAGGMYVDDSDRFISPDVDSEQLRLQALHHQFVASALVTKFAHELDANLKI
GCMLAYRMLYPLTSKPTDIALVQTATEFNNFYCGDVQVKGRYAYFAKRYWRDHDIQLDIG
ADDEAILAAGTVDFYTFSYYQSSTMTTTGEGEQAGGNFFSGVKNPYLDRSDWGWEIDPRG
LRTALNQIYDRYHVPLMVVENGFGTRDDLIEKDGRKTVEDTERINYLQAHIAAMADAIQD
GVDLIGYTSWAPIDLVSASTGEMAKRYGYIFVDKHDDGSGTLARYRKQSFYWYQQVIQQN
GL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaccaacaattccccgaaaatttcctctggggcggcgctactgccgctaatcaa
cttgaaggcgcctaccaaactgacggcaaagggctctcaactagcgacctgctactaggc
ggcaacgtcaacacgccgcgtaagacgacccgtgaactagtacctgatgccttctatcca
agtcatgaagccattgatcattttcaccgcttcaaagaagacatcgccttgtttgccgaa
atgggcttcaagctctatcggttctccattgcctggacgcgcatttttccaaccggatta
gaaaccgagccaaatgaggccggtttggcgttctacgatcaaatcattgcggaactcaaa
cgctacaacatcgaacctttgattacgatttcccatttcgaatcgccaatcggcttaaca
aaggccttcaatggctgggcggctcgcgatatgattgccgcttacgtccggtttgccaaa
gtcatcatcaaccgctatcaccacgacgtcaaatactggctaaccttcaacgaaattaac
atgctcacccgccccatgggtgcctatctagcaggcggtatgtatgtggacgattctgat
cgcttcatcagtccagatgtcgactccgaacagctgcgcctgcaagcactacaccaccaa
ttcgtcgccagtgccttagtgaccaagtttgcccacgagctcgatgcaaacttgaaaatt
ggctgcatgctggcttatcgcatgttgtacccattaaccagcaaacctactgacattgcg
ctcgtccaaaccgcgacagaatttaataacttctactgtggcgacgtacaggtaaaaggc
cgctacgcctactttgccaagcgctattggcgtgatcacgacatccagctagatatcggc
gctgacgatgaggcaattcttgcggctggcaccgttgatttctacaccttctcctactac
caatccagcaccatgaccaccacgggtgaaggcgagcaagcaggcggcaacttcttcagt
ggcgtcaaaaacccctatcttgatcgtagcgactggggctgggaaattgatccacgtggc
ctgcgcacagcactcaatcaaatatatgatcgttaccatgtaccattaatggtcgtcgaa
aacggcttcgggacacgtgacgacctgatcgaaaaagacggcagaaaaaccgtcgaagac
accgaacgtatcaactacttgcaagcccacatagccgccatggcagatgcgattcaagat
ggcgttgatcttatcggctatacctcgtgggcacccattgatctcgtctctgccagcaca
ggcgaaatggcgaaacgatatgggtatatcttcgttgataaacatgatgacggtagcggt
actttggcgcgctatcgaaagcagtcgttttattggtatcagcaggttattcagcaaaac
ggtttgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system