KEGG   Lactobacillus casei LC2W: LC2W_1267Help
Entry
LC2W_1267         CDS       T01956                                 

Definition
hypothetical protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lce  Lactobacillus casei LC2W
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lce00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1223180..1224628)
Genome map
AA seq 482 aa AA seqDB search
MTNQQFPENFLWGGATAANQLEGAYQTDGKGLSTSDLLLGGNVNTPRKTTRELVPDAFYP
SHEAIDHFHRFKEDIALFAEMGFKLYRFSIAWTRIFPTGLETEPNEAGLAFYDQIIAELK
RYNIEPLITISHFESPIGLTKAFNGWAARDMIAAYVRFAKVIINRYHHDVKYWLTFNEIN
MLTRPMGAYLAGGMYVDDSDRFISPDVDSEQLRLQALHHQFVASALVTKFAHELDANLKI
GCMLAYRMLYPLTSKPTDIALVQTATEFNNFYCGDVQVKGRYAYFAKRYWRDHDIQLDIG
ADDEAILAAGTVDFYTFSYYQSSTMTTTGEGEQAGGNFFSGVKNPYLDRSDWGWEIDPRG
LRTALNQIYDRYHVPLMVVENGFGTRDDLIEKDGRKTVEDTERINYLQAHIAAMADAIQD
GVDLIGYTSWAPIDLVSASTGEMAKRYGYIFVDKHDDGSGTLARYRKQSFYWYQQVIQQN
GL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaccaacaattccccgaaaatttcctctggggcggcgctactgccgctaatcaa
cttgaaggcgcctaccaaactgacggcaaagggctctcaactagcgacctgctactaggc
ggcaacgtcaacacgccgcgtaagacgacccgtgaactagtacctgatgccttctatcca
agtcatgaagccattgatcattttcaccgcttcaaagaagacatcgccttgtttgccgaa
atgggcttcaagctctatcggttctccattgcctggacgcgcatttttccaaccggatta
gaaaccgagccaaatgaggccggtttggcgttctacgatcaaatcattgcggaactcaaa
cgctacaacatcgaacctttgattacgatttcccatttcgaatcgccaatcggcttaaca
aaggccttcaatggctgggcggctcgcgatatgattgccgcttacgtccggtttgccaaa
gtcatcatcaaccgctatcaccacgacgtcaaatactggctaaccttcaacgaaattaac
atgctcacccgccccatgggtgcctatctagcaggcggtatgtatgtggacgattctgat
cgcttcatcagtccagatgtcgactccgaacagctgcgcctgcaagcactacaccaccaa
ttcgtcgccagtgccttagtgaccaagtttgcccacgagctcgatgcaaacttgaaaatt
ggctgcatgctggcttatcgcatgttgtacccattaaccagcaaacctactgacattgcg
ctcgtccaaaccgcgacagaatttaataacttctactgtggcgacgtacaggtaaaaggc
cgctacgcctactttgccaagcgctattggcgtgatcacgacatccagctagatatcggc
gctgacgatgaggcaattcttgcggctggcaccgttgatttctacaccttctcctactac
caatccagcaccatgaccaccacgggtgaaggcgagcaagcaggcggcaacttcttcagt
ggcgtcaaaaacccctatcttgatcgtagcgactggggctgggaaattgatccacgtggc
ctgcgcacagcactcaatcaaatatatgatcgttaccatgtaccattaatggtcgtcgaa
aacggcttcgggacacgtgacgacctgatcgaaaaagacggcagaaaaaccgtcgaagac
accgaacgtatcaactacttgcaagcccacatagccgccatggcagatgcgattcaagat
ggcgttgatcttatcggctatacctcgtgggcacccattgatctcgtctctgccagcaca
ggcgaaatggcgaaacgatatgggtatatcttcgttgataaacatgatgacggtagcggt
actttggcgcgctatcgaaagcagtcgttttattggtatcagcaggttattcagcaaaac
ggtttgtaa

DBGET integrated database retrieval system