KEGG   Lactobacillus casei LC2W: LC2W_1469Help
Entry
LC2W_1469         CDS       T01956                                 

Definition
Exodeoxyribonuclease V alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lce  Lactobacillus casei LC2W
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lce03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1412068..1414536
Genome map
AA seq 822 aa AA seqDB search
MDTREETVTGRVKSIFFQNPTNFFKILLIEISATTITWTESDIVVTGTFGDIKEDATYTF
TGHVVDHPKYGQQFQADNYHADQPTNKSGLVDYLSSDKFPGIGPKTATKIIDHLGMDAID
KILDDPKVLAGLGMTAAKRDMLATNLKSNQGMERVIIGLNDYGFTSNMAGRIYQQYQNDA
LDVIKHNPYQLINDIDGIGFTRADQIAAKLAIAPTSQLRLGGAVMDTLQRLTDGEGDTYV
TLKSLVTQTLDLLERARNVAVSPDAVGQAIVTLAKDNALIAEGDRIFPKRLYDAEWQIGR
QLKGLAEADATATEPELAEIEKTLAAVEADTGIAYDATQRKAIVTALQSPIFLLTGGPGT
GKTTVTDGIVRTYARLHDLSLDLDQYTTDEPFPIMLAAPTGRAAKRISETTQLPASTIHR
LLGLGVDTQEFAPNELPNGLLIIDEMSMVDTYLFRTLLTALHPGMKIVLVGDKDQLPSVG
PGQVFADLLRSGVLPQTALTHIHRQDADSSIIPLAHAVNAGKLPDDFTKPQVDRSFLACA
PSQVPEVVGQVVQRAAVKQFSIADIQVLAPMYRGTAGIDRLNPLLQNILNPKRSARTKAI
QFGETEYRIGDKVLQLVNDPNQNVFNGEIGQIVGITLGKEAESKTDELTIDFDGNEITCK
RSDFNKITLAYATSIHKAQGSEFPMVILPLTLQSRRMLRRNLLYTAITRAKSFLILVGEL
AAFQEAVSEVAVNRHTGLVDRLMTVFGKTVAPQVADDSATKDISASPSEPQIDTTALDLD
NEVKQQPPAAHQLTPALVASQRIDPMIGMDGITPQMFMTKEN
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atggacacgcgtgaggagactgtcaccggtcgggtcaaaagtatctttttccagaatcca
acaaatttttttaaaattcttctgatcgaaatctctgcgacgactatcacctggacagag
tcagatattgtggtgacaggaacgtttggtgatattaaggaagatgcgacctacacgttc
actgggcatgtcgtggatcatcctaagtatgggcagcagtttcaagcagacaattatcat
gcggatcagccgacgaataaaagtgggctggtcgattatttgagctcagataagttcccg
gggatcggtccgaaaacggcaacgaaaattatcgatcatttgggtatggatgctattgac
aagattctggatgatccgaaggttttggcgggcttaggcatgacagctgccaagcgtgat
atgttggcgacgaatctgaaatcgaaccaaggcatggaacgggttattattggtcttaac
gattacggttttactagcaatatggcaggtcgtatttaccaacaatatcaaaatgacgcc
ttagatgtgattaagcacaatccgtatcaattgattaacgatattgatggtatcggcttt
actcgggctgatcagattgcggcaaaattggcgattgcaccgacttcgcagcttcgtctt
ggcggtgcagtgatggataccctgcagcggttgactgatggcgaaggtgatacctatgtg
acgctgaagtcattggtcactcagacacttgatttattggaacgggcgagaaacgttgcc
gtttcgccagacgcagtaggacaggcaattgtgacgctggctaaagacaatgccctgatt
gcagaaggcgaccgcattttcccgaaacgattatatgatgctgaatggcagattggtcgg
caactaaaaggactggcagaggcagacgcaacggctactgaacctgaattggctgagatt
gaaaaaacgttagcggcggtcgaggcggataccggtattgcgtatgatgcgacgcaaaga
aaagccattgtcacggcgttacagtcgcccatttttctgttgactggaggacctggtact
gggaaaaccacagtaacagatggtatcgtgcggacgtatgcacggttgcatgacctttca
ttggatcttgatcagtatacgactgacgagccatttccaatcatgctggcagcgccaacc
gggcgggcagcgaaacggattagtgagaccacccaactgccagccagtacgattcatcgc
ctgctcggtttaggtgttgacacgcaagaatttgcacctaatgagttaccgaatggcctg
ttgattattgatgagatgtcaatggttgacacttacttgttccggacgcttttaacggca
ttacatcccggaatgaaaattgtcttggttggcgataaagaccagttaccaagtgtcggt
cccggacaagtattcgctgatttattgcgcagcggcgtgctgccgcaaacagcgctgacg
catattcatcgtcaggatgccgacagttcaattattccgctagcgcatgcagtgaatgct
ggcaagttgccggatgattttaccaagccgcaagttgatcgcagttttttggcgtgtgcg
cctagtcaggtacctgaagttgtcggacaagtggtgcaacgagccgcagtcaaacaattc
tcgatcgcggatattcaagtgttggcacctatgtaccgcggaaccgctggcattgatcgt
ttgaatccgttactgcaaaacattttgaatccaaaacgcagtgcccgaacgaaagcaatt
cagtttggagaaacggaatatcgaattggtgataaggtgttgcaactggtcaatgatccc
aaccaaaatgtttttaacggtgaaatcggtcagattgtcggcattactttgggcaaggaa
gccgaaagcaagacagatgaattaacgattgatttcgacggcaatgaaatcacttgcaaa
cgcagtgattttaataagattacgcttgcttatgccacctcgattcataaagcccaaggc
agtgagtttccgatggtgattttgccgctaaccttgcaaagccgccggatgttgcgacgt
aacttgttgtacactgccattacgcgggctaaatcatttttgattttggttggcgagctg
gcagcctttcaggaagcggtcagtgaagtagccgttaatcgacatactgggctggtcgat
cggctcatgactgtatttggcaaaaccgttgcccctcaggttgctgatgattcagcaacc
aaggatatttcagcaagtcccagtgagccgcaaattgacacaactgcacttgacttggat
aatgaagttaaacaacaaccaccggcagcgcaccaattaacgcctgccttggtggcttct
caacgaatcgatcccatgattgggatggatggtatcactccgcaaatgtttatgacgaag
gagaattaa

DBGET integrated database retrieval system