KEGG   Lactobacillus casei LC2W: LC2W_1480Help
Entry
LC2W_1480         CDS       T01956                                 

Definition
(GenBank) Pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lce  Lactobacillus casei LC2W
Pathway
lce00010  Glycolysis / Gluconeogenesis
lce00020  Citrate cycle (TCA cycle)
lce00620  Pyruvate metabolism
lce01100  Metabolic pathways
lce01110  Biosynthesis of secondary metabolites
lce01120  Microbial metabolism in diverse environments
lce01130  Biosynthesis of antibiotics
lce01200  Carbon metabolism
Module
lce_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LC2W_1480
   00020 Citrate cycle (TCA cycle)
    LC2W_1480
   00620 Pyruvate metabolism
    LC2W_1480
Enzymes [BR:lce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LC2W_1480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H DUF1780
Motif
Other DBs
NCBI-ProteinID: AEA53813
Position
1424942..1426606
Genome map
AA seq 554 aa AA seqDB search
MAFEFKLPELGEGLAEGEIVKWDVKPGDDIKEDDTLLEVQSDKSVEEIPSPVSGKILKIL
VPEGETASVGDLLVEIDDGSGPAAAPAAPATATAAPATPAPATPAVQPAPAQSVYQFKLP
ELGEGLAEGEIVKWSVKPGDQIKEDDTLLEVQSDKSVEEIPSPVAGTVVKILVPEGETAT
VGEALVDIDAPGHNDTSVATEAGAAPQPVAATPAATPAAPAAGGVPAITDPNREILAMPS
VRQYAREQGIDISQVPATGKHGRITKADVDAFKTGAPAASAQPAAPAAQAQPQPATAKPA
APAAPKPQAVAPYVSSDNEAELETREKMTPTRKAIAKAMLASKQRSPHVTSFDDVEVSKL
MAHRKKYKQYAADKGIKLTFLPYIVKALVTVLREYPEFNASIDDTTDEIVYKHYFNIGIA
TNTDHGLYVPVIKNADAKSMFEIAKEISENAQKAYDSKLKPDEMRGGSMTISNVGSIGGG
WFTPVINQPEVAILGVGKIAKEPYVNEDNEIVVGNMLKLSLSYDHRLIDGALAQTALNLM
DKLLADPDLLLMEG
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattcaaactgccagaacttggcgaaggtttggcagaaggcgaaatcgtt
aagtgggacgtcaaacctggtgatgacatcaaggaagacgataccttacttgaggttcaa
agtgataaaagtgttgaagagattccatccccggtctccggcaaaattttaaaaattctt
gttccagaaggggaaaccgcgtcagttggtgatttattggttgaaatcgatgatggctcc
ggaccggcagctgcaccggctgcacctgcgactgcaacagcagcccctgcgacacccgct
ccagcaacgcctgctgtgcaacctgcacctgcgcaatcggtttatcagtttaagttaccc
gaactaggcgaaggtttggcagaaggcgaaattgttaaatggtcagtcaagcctggcgat
caaatcaaagaggacgacacgctgttagaagttcaaagcgacaagagtgtcgaagaaatt
ccttctccagttgccggaacggttgttaagattctggtaccagaaggcgaaaccgcgaca
gtcggtgaagcgctggttgatattgatgcaccgggtcataatgacacatcggttgctact
gaggctggcgctgcaccgcagccggttgctgcaacaccggctgcgacgccagctgcacca
gcagcgggtggcgtgccggccatcaccgatccgaaccgggaaattttagcaatgccatct
gtgcgtcagtatgcacgcgaacagggcattgacatctcacaagtgccagcaaccggcaaa
catggccgaattaccaaggctgatgtcgatgcattcaagacgggcgcaccagctgcatct
gcacagccagcagcccctgctgctcaggcacaaccgcaaccagccacagcaaagccagct
gcaccggcagcaccaaagccgcaagcagttgcaccatacgtttcgagtgataatgaagct
gaacttgaaacccgtgaaaagatgaccccaactcggaaagcgattgctaaggcgatgctt
gcttctaagcaacgtagcccgcatgtgacgagttttgatgacgttgaagtttctaagtta
atggctcatcgcaagaagtacaagcaatacgcagctgataaaggtatcaagttaaccttc
ctgccgtatatcgtcaaagcacttgtgacggtgttgcgtgaatatccagaattcaatgcg
tccattgatgatacaacggatgaaattgtctataagcattacttcaacattgggattgca
acgaatacggatcacggcttgtatgtgcctgtgatcaagaatgccgatgcaaagagtatg
tttgaaattgctaaggaaattagtgaaaatgcccagaaggcttatgacagcaaactaaag
ccggatgaaatgcgcggtggctccatgaccatcagtaacgttgggtcaattggcggcggc
tggttcaccccagtgatcaatcaacctgaagttgcgattctcggagtgggtaaaattgct
aaggaaccttatgtcaacgaagacaacgaaattgtggttggcaacatgttgaaattaagt
ttgagctatgaccatcgtttgattgacggcgcgttagcacaaaccgccttgaatctgatg
gataaattgttggcagatcctgatctgctgttgatggagggataa

DBGET integrated database retrieval system