KEGG   Lactobacillus casei LC2W: LC2W_1528Help
Entry
LC2W_1528         CDS       T01956                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase isozyme 1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lce  Lactobacillus casei LC2W
Pathway
lce00010  Glycolysis / Gluconeogenesis
lce00030  Pentose phosphate pathway
lce00051  Fructose and mannose metabolism
lce00052  Galactose metabolism
lce00680  Methane metabolism
lce01100  Metabolic pathways
lce01110  Biosynthesis of secondary metabolites
lce01120  Microbial metabolism in diverse environments
lce01130  Biosynthesis of antibiotics
lce01200  Carbon metabolism
lce01230  Biosynthesis of amino acids
lce03018  RNA degradation
Module
lce_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lce_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:lce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LC2W_1528 (pfkA)
   00030 Pentose phosphate pathway
    LC2W_1528 (pfkA)
   00051 Fructose and mannose metabolism
    LC2W_1528 (pfkA)
   00052 Galactose metabolism
    LC2W_1528 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    LC2W_1528 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LC2W_1528 (pfkA)
Enzymes [BR:lce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LC2W_1528 (pfkA)
Protein phosphatases and associated proteins [BR:lce01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LC2W_1528 (pfkA)
Messenger RNA biogenesis [BR:lce03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LC2W_1528 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AEA53861
Position
1480961..1481920
Genome map
AA seq 319 aa AA seqDB search
MKRIGILTSGGDAPGMNAAVRAVARKAMHEGLEVYGINYGFAGLVAGDIFKMNESTVGDK
IQRGGTMLYSARYPQFAQEEGQLRGVEQLNKFGIEALVVIGGDGSYHGALALTRHGFNTI
GLPGTIDNDIPYTDFTIGFDTAVNTVVEAVDRLRDTAASHERTFVIEVMGREAGDIALWS
GVAGGAEDVIIPEHDFDVKKIASKLQSSRERGQKHAVILLAEGVMHADQFAKELAAHGDF
QLRSTVLGHIVRGGAPSARDRVLASQMGSYAVELLLQGKGALAVGIENNKITAHDVRTLF
DAKHHAELSLYTLAEELTF
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattggtattttgaccagtggcggggatgcgcctggcatgaacgccgcggtc
cgcgctgttgctcgcaaggcgatgcacgaaggccttgaagtatatggcatcaattatgga
tttgctgggttagttgccggcgacattttcaaaatgaatgaatcaactgtcggtgataag
attcaacgcggcgggaccatgttatattccgcacgttatccacaatttgcgcaagaagaa
ggccagttgcgcggggtcgaacaattaaacaagtttggcatcgaggcgttggtcgtcatc
ggcggagacggctcttatcacggtgcactagctttgacgcgtcacggtttcaacaccatt
ggcctgccaggaacgatcgacaacgatattccttacacggacttcacgattggctttgat
actgccgttaatacagttgtggaagctgttgaccgtcttcgcgataccgcggcttcgcat
gaacgaacctttgtcattgaagtcatgggtcgtgaagctggggacattgccctttggtcg
ggcgtcgccggtggtgccgaggatgtcatcattccagaacacgactttgacgttaagaaa
attgcgtcgaagttgcaaagttctcgtgaacgtggtcaaaagcatgcggtcattcttttg
gcagaaggcgtgatgcacgctgatcaatttgccaaggaattagccgcacatggcgatttc
caattacgttcgacagttctgggacacattgttcgtggcggtgcaccgtccgcacgtgat
cgcgttttggcttcacaaatgggttcatacgcggttgaacttttgttgcaaggcaaaggc
gctttggctgtcggcattgaaaacaacaagatcacggcacatgatgttcggaccttgttt
gatgccaagcatcacgcagaactttcgctctacaccttagcggaagagttaacattttaa

DBGET integrated database retrieval system