KEGG   Lactobacillus casei LC2W: LC2W_1553Help
Entry
LC2W_1553         CDS       T01956                                 

Gene name
folA
Definition
Dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lce  Lactobacillus casei LC2W
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LC2W_1553 (folA)
   00670 One carbon pool by folate
    LC2W_1553 (folA)
Enzymes [BR:lce01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     LC2W_1553 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1504756..1505247
Genome map
AA seq 163 aa AA seqDB search
MVAFLWAQDRDGVIGKDGHLPWHLPDDLHYFRTQTEGKMMVVGRRTYESFPKRPLPDRTN
VVLTHQADYQAPGAIVLHQVAEVLDYAKEHADQALVIAGGAQIFSAFKDMVDTLLVTRLA
GSFAGDTKMIPLDWDAFTKTSSRTVEDQNPALTHTYEVWQKQK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggtagcatttttgtgggcgcaggatcgggatggtgtaatcggtaaagacggccatttg
ccatggcatttgccagatgatttgcattatttccggactcagactgaaggaaaaatgatg
gtggttgggcgtcgcacgtacgaaagttttccaaaacggccattaccagatcgtacgaac
gtggttttgacgcaccaggctgattaccaggcaccaggcgcgattgtcttgcatcaggtt
gctgaagtgcttgattatgcgaaggaacatgcagatcaggcattagtcatcgccggtggt
gctcaaatctttagcgcctttaaagacatggttgataccttgctcgtgacccgtctagct
ggcagttttgcaggtgacactaaaatgattccactagattgggatgcgtttactaaaacc
tcaagccgaactgtcgaagatcaaaaccccgctttgacgcatacttatgaagtttggcaa
aagcaaaaatga

DBGET integrated database retrieval system