KEGG   Lactobacillus casei LC2W: LC2W_1833Help
Entry
LC2W_1833         CDS       T01956                                 

Definition
(GenBank) hypothetical protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lce  Lactobacillus casei LC2W
Pathway
lce00010  Glycolysis / Gluconeogenesis
lce00052  Galactose metabolism
lce00500  Starch and sucrose metabolism
lce00520  Amino sugar and nucleotide sugar metabolism
lce00521  Streptomycin biosynthesis
lce01100  Metabolic pathways
lce01110  Biosynthesis of secondary metabolites
lce01120  Microbial metabolism in diverse environments
lce01130  Biosynthesis of antibiotics
lce01200  Carbon metabolism
Module
lce_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lce_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LC2W_1833
   00052 Galactose metabolism
    LC2W_1833
   00500 Starch and sucrose metabolism
    LC2W_1833
   00520 Amino sugar and nucleotide sugar metabolism
    LC2W_1833
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LC2W_1833
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LC2W_1833
Enzymes [BR:lce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LC2W_1833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AEA54165
Position
complement(1777551..1778513)
Genome map
AA seq 320 aa AA seqDB search
MNDKKLIGVDLGGTTVKFAILTTDGEIQQRWSIDTNILDEGSHILPDIIDSINEHLKLYN
MTPNDFVGIGMGSPGSVDIEAGTVIGAYNLNWKTLQQAKKDIEAGTGIPFSIDNDANVAA
LGERWKGAGENDANVTFVTLGTGVGGGIIADGNLLHGVAGSAGELGHVTVDPVNGYLCTC
GKRGCLETVASATGVVRVARDMAEEFAGDSKLKQTLDDGDEISSKIVFDLAKTGDKLALM
IVDRVSYFLGLALANVGNLLNPKFIVIGGGVSAAGDFLLKRVDKYFKENTFPNVRETTSL
RLATLGNTAGVIGAASLALK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacaaaaaattaattggtgtcgatctgggcggcacaacggttaaattcgcgatc
ttaaccactgatggtgagattcaacagcgctggagcatcgatactaatattttggatgaa
ggcagtcacatcttgccggatatcattgattcgatcaacgaacatctcaaactctacaac
atgacaccgaatgattttgtcggtatcggtatgggctcacctggttccgttgatattgaa
gcaggcacggtaattggcgcttacaacttgaattggaaaaccttgcagcaggctaagaag
gatattgaggctggtactgggattccctttagtattgataacgacgccaatgttgctgcc
ttgggcgaacgttggaaaggcgctggcgaaaatgacgccaatgtaactttcgtaacgctt
ggcacaggcgttggcggcggcattattgccgatggtaacttattgcatggtgttgcaggc
tcagcaggcgaactcggacacgtaactgttgatccggtcaatggttatctctgtacttgc
ggcaaacgcggttgtctcgaaactgtagccagtgcgactggcgttgtccgggtggcccgg
gatatggctgaagaattcgctggcgactccaaactgaagcagacgttagatgatggcgat
gagatttctagcaaaattgtttttgatcttgccaaaaccggcgacaaacttgcgttgatg
attgttgaccgggttagctactttcttggcttggcattggcaaatgtcggcaatctgctg
aatccgaaattcatcgtcattggtggcggcgtttcagcagcaggcgactttttgctgaag
cgagttgataagtatttcaaggaaaatacgttcccgaatgttcgggaaacaacaagtctg
cgtctggcaacgctaggtaacactgctggcgttatcggagctgccagccttgcacttaag
taa

DBGET integrated database retrieval system