KEGG   Lactobacillus casei LC2W: LC2W_1833Help
Entry
LC2W_1833         CDS       T01956                                 

Definition
hypothetical protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lce  Lactobacillus casei LC2W
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LC2W_1833
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LC2W_1833
   00052 Galactose metabolism
    LC2W_1833
   00500 Starch and sucrose metabolism
    LC2W_1833
   00520 Amino sugar and nucleotide sugar metabolism
    LC2W_1833
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LC2W_1833
   00524 Butirosin and neomycin biosynthesis
    LC2W_1833
Enzymes [BR:lce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LC2W_1833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1777551..1778513)
Genome map
AA seq 320 aa AA seqDB search
MNDKKLIGVDLGGTTVKFAILTTDGEIQQRWSIDTNILDEGSHILPDIIDSINEHLKLYN
MTPNDFVGIGMGSPGSVDIEAGTVIGAYNLNWKTLQQAKKDIEAGTGIPFSIDNDANVAA
LGERWKGAGENDANVTFVTLGTGVGGGIIADGNLLHGVAGSAGELGHVTVDPVNGYLCTC
GKRGCLETVASATGVVRVARDMAEEFAGDSKLKQTLDDGDEISSKIVFDLAKTGDKLALM
IVDRVSYFLGLALANVGNLLNPKFIVIGGGVSAAGDFLLKRVDKYFKENTFPNVRETTSL
RLATLGNTAGVIGAASLALK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacaaaaaattaattggtgtcgatctgggcggcacaacggttaaattcgcgatc
ttaaccactgatggtgagattcaacagcgctggagcatcgatactaatattttggatgaa
ggcagtcacatcttgccggatatcattgattcgatcaacgaacatctcaaactctacaac
atgacaccgaatgattttgtcggtatcggtatgggctcacctggttccgttgatattgaa
gcaggcacggtaattggcgcttacaacttgaattggaaaaccttgcagcaggctaagaag
gatattgaggctggtactgggattccctttagtattgataacgacgccaatgttgctgcc
ttgggcgaacgttggaaaggcgctggcgaaaatgacgccaatgtaactttcgtaacgctt
ggcacaggcgttggcggcggcattattgccgatggtaacttattgcatggtgttgcaggc
tcagcaggcgaactcggacacgtaactgttgatccggtcaatggttatctctgtacttgc
ggcaaacgcggttgtctcgaaactgtagccagtgcgactggcgttgtccgggtggcccgg
gatatggctgaagaattcgctggcgactccaaactgaagcagacgttagatgatggcgat
gagatttctagcaaaattgtttttgatcttgccaaaaccggcgacaaacttgcgttgatg
attgttgaccgggttagctactttcttggcttggcattggcaaatgtcggcaatctgctg
aatccgaaattcatcgtcattggtggcggcgtttcagcagcaggcgactttttgctgaag
cgagttgataagtatttcaaggaaaatacgttcccgaatgttcgggaaacaacaagtctg
cgtctggcaacgctaggtaacactgctggcgttatcggagctgccagccttgcacttaag
taa

DBGET integrated database retrieval system