KEGG   Lactobacillus casei LC2W: LC2W_1876Help
Entry
LC2W_1876         CDS       T01956                                 

Definition
hypothetical protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lce  Lactobacillus casei LC2W
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LC2W_1876
   01230 Biosynthesis of amino acids
    LC2W_1876
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LC2W_1876
  Energy metabolism
   00680 Methane metabolism
    LC2W_1876
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LC2W_1876
Enzymes [BR:lce01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LC2W_1876
Exosome [BR:lce04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LC2W_1876
  Exosomal proteins of melanoma cells
   LC2W_1876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1817484..1818053
Genome map
AA seq 189 aa AA seqDB search
MATIDLVRHAEPDITIHDDFLRPLTSAGQRQTQQLVDSLHQYPYTAFFSSPLKRAVDTIT
PIADDHGLPVQKNELLVERKMPAWLPNFSDYVNQQWQDLTFFEKPGESIHQVQERYLSFL
YGLPSSAFVAVGSHGTAISSLVEAAIPGIGYHFFSKLGYAAVTRIEMHAGNMVHLTVWEQ
KSKTFNVLK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaattgacttagtgaggcatgctgaaccagacatcacgattcatgatgatttt
ttgcggccactgaccagcgctggtcagcggcaaactcagcagttggttgacagtttgcat
caatatccgtacacggcctttttttcaagcccactcaaacgtgccgttgatacgatcaca
ccgattgcagatgatcacggcttacccgttcaaaaaaacgaactattggtggagcgaaag
atgcctgcatggctgccaaatttttctgactatgttaatcagcagtggcaagatttaaca
ttctttgaaaaacctggtgaatctattcatcaagttcaagaacgttacctttcattttta
tatggactgccaagttcggcattcgtcgctgtcggtagtcatggcacggcgataagcagt
cttgtcgaagcggccatccccggtataggctatcattttttctcgaaacttggttacgcc
gctgtcacccgtatcgaaatgcatgcaggcaatatggttcacctaactgtctgggaacaa
aaatcaaagacatttaacgttctaaaatag

DBGET integrated database retrieval system