KEGG   Lactobacillus casei LC2W: LC2W_2165Help
Entry
LC2W_2165         CDS       T01956                                 

Definition
(GenBank) Fructose-1-6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
lce  Lactobacillus casei LC2W
Pathway
lce00010  Glycolysis / Gluconeogenesis
lce00030  Pentose phosphate pathway
lce00051  Fructose and mannose metabolism
lce00680  Methane metabolism
lce01100  Metabolic pathways
lce01110  Biosynthesis of secondary metabolites
lce01120  Microbial metabolism in diverse environments
lce01130  Biosynthesis of antibiotics
lce01200  Carbon metabolism
Module
lce_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LC2W_2165
   00030 Pentose phosphate pathway
    LC2W_2165
   00051 Fructose and mannose metabolism
    LC2W_2165
  Energy metabolism
   00680 Methane metabolism
    LC2W_2165
Enzymes [BR:lce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     LC2W_2165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos_2
Motif
Other DBs
NCBI-ProteinID: AEA54497
Position
complement(2104917..2106848)
Genome map
AA seq 643 aa AA seqDB search
MDLYSELTAKYQTVPAIATEIINLEAILNLPKPTEAFMSDIHGEYNAFQHVLRNGSGNVK
SKIRSCFRDEMTEATLQRFAFLVYYPSERMAAIHREMAGDDLQQWYLTTFRRLIRLLAFT
ATKYTRSKVRKAMAPEFVYITEELLYNDADTPDKLAYYWQIIRNLIVLEQADQWIAATCQ
TIQRLTVDHFHVVGDIYDRGPAPDQVVESLIRRDRRHSVDIQWGNHDILWIGAAAGSALC
IANLVRISARYNNLSILEDVYGINLRHLARLAEQYYQDNPAFSPKMERSDRPITEAERLQ
ITQIHQAIAMIQFKLEGPVIKRRPEFDMDHRLVLEKLAPDFSTIKLNGDTYTIENGCFAT
VDPADPYKLLPEEQEVIDSLVESFTHSEKLHRHMDFLLDHGSMYLRYNRNLLLHGCVPVD
EDGNFIGLTIKGTTYTGRQLFDMLEANLRLAYSQPTENADLATDLMWYLWTGPNSPLFGK
HDMTTFERYFISDPKAHVEGRNPYYHLRKDPEFIKKILAEFVLDPEVGHVINGHTPVKKG
TDPIMANNKMIVIDGGFSKPYQKTTGIGGYTLLDNSYGMQLVTHQPFTTKADAIANLTDI
ISTRRVVETEARRRTVAETDIGTELQDEVEVLKRRLGELREEE
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggacttgtacagtgaactgacggcgaagtatcaaacggtgccagcgattgcgactgaa
atcattaatctggaagccattttgaatttacctaagccgacggaagcgtttatgagcgat
atccacggggagtataacgcctttcagcatgttttgcggaacggcagcgggaatgtgaaa
agcaaaattcgttcctgttttcgcgatgaaatgacggaggcgaccctgcagcgcttcgct
tttttggtgtactatccgtctgagcgaatggcggcgattcatcgggagatggcaggggat
gacttgcaacagtggtatttgacgacttttcgccggttgattcgcttgctggcgttcacc
gcgaccaaatacacgcgttcgaaagttcgcaaggcgatggcaccggagtttgtctatatc
accgaagagttgctgtacaatgatgccgatacgcctgacaagctggcttattattggcaa
attattcgtaatttaatcgttcttgaacaggccgatcagtggattgcggcaacgtgtcaa
acgattcaacgtttaacggtagatcattttcacgttgtaggcgatatctatgatcgagga
ccggcgccggatcaggtggttgaaagcttgattagacgtgatcggcgtcattcagtggat
attcaatggggcaaccatgatattctttggatcggcgccgccgcgggctcggctttgtgc
attgccaatttggtgcggatttccgcgcggtataacaatttaagtattctcgaagatgtt
tatgggattaatttgcggcatttggcccgattagcggaacaatactatcaagataatccc
gccttttcaccaaaaatggagcggtcagatcgaccaataactgaggcggagcgacttcaa
attacgcagattcatcaggcgattgcgatgattcaatttaagttggaaggaccagtgatt
aaacgtcggcctgaatttgacatggatcatcggctagtgctggagaaactggcacctgat
ttttcaaccatcaagttgaatggtgatacttatacgattgaaaacggctgttttgcgacg
gttgatccggctgatccttacaagttgttgccagaggagcaagaggtcattgactcgctg
gttgagtcctttacgcactctgaaaagttgcatcgccacatggattttctacttgatcac
ggcagtatgtatttgcggtacaaccggaatttgttgctgcacgggtgtgtgccggtggac
gaggatggcaattttattggcttgaccattaaagggacgacttatactggccgtcaacta
tttgacatgctggaagcaaatcttcggttggcatacagtcaaccaacggagaatgctgac
ttagcaaccgatctgatgtggtatctctggaccggtccaaattcaccgctttttggcaag
cacgacatgacgacctttgaacgctatttcattagcgatccgaaagcccatgtcgaaggc
cgtaatccgtattatcacctgcgtaaggacccggaatttatcaaaaagatcttggcggaa
tttgtcctcgatcctgaagtcggccatgtcattaatggtcatacgccagtcaaaaaaggc
accgaccccattatggcaaacaacaaaatgatcgtcatcgacggcggcttttctaaaccg
tatcaaaaaaccaccgggatcggcggttacacgcttttggataattcttatggtatgcaa
ctagtgacgcaccaaccattcaccacaaaagccgatgctatcgccaaccttactgatatc
atttcaacccgtcgcgtcgtcgaaaccgaagcccgccgccgaacggtagcagaaactgac
attggcactgagctacaggatgaggttgaggtgttgaagcggcgattgggtgagttgcgg
gaagaagaatag

DBGET integrated database retrieval system