KEGG   Lactobacillus casei LC2W: LC2W_2283Help
Entry
LC2W_2283         CDS       T01956                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lce  Lactobacillus casei LC2W
Pathway
lce00010  Glycolysis / Gluconeogenesis
lce00260  Glycine, serine and threonine metabolism
lce00680  Methane metabolism
lce01100  Metabolic pathways
lce01110  Biosynthesis of secondary metabolites
lce01120  Microbial metabolism in diverse environments
lce01130  Biosynthesis of antibiotics
lce01200  Carbon metabolism
lce01230  Biosynthesis of amino acids
Module
lce_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lce_M00002  Glycolysis, core module involving three-carbon compounds
lce_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LC2W_2283
  Energy metabolism
   00680 Methane metabolism
    LC2W_2283
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LC2W_2283
Enzymes [BR:lce01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LC2W_2283
Membrane trafficking [BR:lce04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LC2W_2283
Exosome [BR:lce04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LC2W_2283
  Exosomal proteins of melanoma cells
   LC2W_2283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: AEA54614
Position
complement(2221025..2221714)
Genome map
AA seq 229 aa AA seqDB search
MAKLVLIRHGQSEWNLSNQFTGWVDVDLSEKGVEEAKHAGQLVKQAGLEFDQAYTSVLTR
AIKTLHYVLEESDQLWIPEMKTWRLNERHYGALQGLNKKETADKYGADQVHIWRRSYDVL
PPLLKATDEGSAAKDRRYADLDPRIIPGGENLKVTLERVIPFWEDHIAPDLLAGKNVIIA
AHGNSLRALTKYIENISDADIMNLEMATGEPVVYDFDEKLNVNSKSKLD
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaattagtattgatccgtcacgggcaaagtgaatggaatttgtccaaccaattt
accggctgggtggatgttgatctgagtgaaaagggtgtcgaagaagcaaagcatgctggc
caattggttaagcaagctggtcttgaattcgatcaggcttacacctcagttttgacccgc
gcgatcaagaccctgcattacgtcttggaagaatccgatcaactttggattccagaaatg
aagacatggcgcctgaacgaacgtcactatggcgctttgcaaggcttgaacaagaaggaa
accgctgataaatacggtgccgatcaagttcacatctggcgtcgttcgtatgacgttttg
ccaccattgttgaaagcaactgacgaaggttcagctgctaaggatcgtcgttacgctgat
cttgacccacggatcattcctggcggcgaaaacctgaaagtgaccctcgaacgggttatc
ccattctgggaagatcatattgcaccagatctgttggctggcaagaatgttatcatcgct
gcccacggtaactcactgcgcgccttgaccaagtacatcgaaaacatttccgatgcagac
atcatgaacttggaaatggcgactggcgaacctgttgtttatgacttcgacgaaaagttg
aacgtcaacagtaagagcaagctggactaa

DBGET integrated database retrieval system