KEGG   Lactobacillus casei LC2W: LC2W_2300Help
Entry
LC2W_2300         CDS       T01956                                 

Definition
(GenBank) hypothetical protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lce  Lactobacillus casei LC2W
Pathway
lce00260  Glycine, serine and threonine metabolism
lce00750  Vitamin B6 metabolism
lce01100  Metabolic pathways
lce01110  Biosynthesis of secondary metabolites
lce01120  Microbial metabolism in diverse environments
lce01230  Biosynthesis of amino acids
Module
lce_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lce00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LC2W_2300
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LC2W_2300
Enzymes [BR:lce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LC2W_2300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N CHASE7
Motif
Other DBs
NCBI-ProteinID: AEA54631
Position
complement(2237603..2239117)
Genome map
AA seq 504 aa AA seqDB search
MRYTSTRDHQVSKTSKEAIKQGISEEGGLFVLPHLADQTLNIHELLDLDYETIAQRVLMI
LLPDFNTDSLKKAIHFAYHQHFSDDRITPVRSVGDFHVLELFHGPTSAFKDVGLQLLPRL
MQLALDPDDRVMILAATSGDTGTAALQGFKDVAQTGITVFYPNHGVSPIQERQMLTVGSD
NTRVFPIAGNFDQAQSAVKTLFTDTSFAARLQAEQVTLSAANSINIGRLIPQVVYYFAAY
SQLVKTQAISMGDEVNFTVPTGNFGDVLAGYYAKSLGLPVHKLIVAANANSELADFLATG
VYDRNRPFLKTVAPSMDIQISSNLERLLYYKSGEDSAYVAHLMQELETTGRYQVRPDVLT
AIQADFAGGFAVDEEVADAIREVWHRDGYLLDPHTAVGYAVQQQYRAASGDNTPNVLLAT
ASPYKFPRVVAKALQSHVPDDDFAAMQMLQQVSGVPIPPNLARLQQLRPQEKIVVAPTDM
GQAIIGAAKEVFNDDQRVRSGNER
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcgatatacgagcacacgggatcatcaagttagcaaaaccagcaaagaggcaatcaaa
caaggtatttctgaagaaggcggtttgtttgtcctgccgcatttggccgatcagacgctg
aacattcatgaactgttagatttagattatgaaacgattgctcagcgagttctcatgatc
ctgttgcctgattttaacaccgactcactaaaaaaagcgattcattttgcgtatcatcag
catttttccgatgatcgcatcacgccagttcgttctgtcggggattttcatgtcttagag
ttatttcatggaccaaccagtgcctttaaggatgtcggcttgcagttgcttccgcgcttg
atgcagttggcacttgatcctgatgatcgggtcatgattttagcggcaaccagcggtgat
acgggaacggcggctctgcaagggtttaaagatgtcgcgcagactgggatcacggttttc
tatcctaatcatggtgtcagtccaattcaggagcgccaaatgttgaccgtgggcagtgac
aatacgcgagttttcccaatcgctggcaattttgatcaggcccaaagcgcagtgaaaacc
ctgttcactgacactagctttgctgctcggttgcaggcagagcaagtaaccctgtcagca
gccaactccatcaatattggccgactgattccgcaagttgtgtattattttgcagcgtat
agccagctggttaaaacacaggccatttcaatgggagatgaggttaatttcactgttcca
actgggaattttggcgatgtgttggcgggctactatgctaagagtctaggcttgcctgtt
cataaactaatcgtggccgccaatgccaacagcgaattggctgattttctggcaaccggt
gtgtatgatcgcaaccgaccgtttttgaaaacagtggcacctagcatggatattcaaatt
tccagtaatctggaacgcctgttgtattataagagtggcgaagatagcgcgtatgttgcg
catttaatgcaggaacttgagacgactggtcgctatcaagttcggccggatgtgttgacc
gcgattcaagcggactttgctggcggttttgctgttgatgaagaggtggcagatgccatt
cgcgaggtttggcatcgggatgggtatttgctggatccgcacactgctgttggttatgcg
gttcaacagcagtaccgggcggcgtctggggataacaccccgaatgtgcttttagccacc
gcaagcccttataaatttccacgcgtggtggccaaggcactacaatcgcacgtaccggat
gatgactttgctgcgatgcaaatgttgcaacaggttagcggtgtgccgattccgccgaat
cttgctcgccttcaacagctaagaccgcaggaaaagattgttgtggcaccaaccgatatg
ggccaagctattattggggcggcgaaggaggtattcaacgatgatcagcgtgtccgttcc
ggcaacgagcgctaa

DBGET integrated database retrieval system