KEGG   Lactobacillus casei LC2W: LC2W_2506Help
Entry
LC2W_2506         CDS       T01956                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lce  Lactobacillus casei LC2W
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LC2W_2506
   01230 Biosynthesis of amino acids
    LC2W_2506
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LC2W_2506
  Energy metabolism
   00680 Methane metabolism
    LC2W_2506
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LC2W_2506
Enzymes [BR:lce01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LC2W_2506
Exosome [BR:lce04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LC2W_2506
  Exosomal proteins of melanoma cells
   LC2W_2506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2443281..2443952)
Genome map
AA seq 223 aa AA seqDB search
MVKLVLLRHGESIANQKNTYTGWSDVGLTAEGKAQAETAGEKIASTGILFDHVHTSVLSR
AIMTAYIVQDKIGQNYLPITKSWRLNERHYGALRGINKDLTRKLFGPDQVASWRRSFSAH
PPLLANPSRTRRYHRYPATIIPRGESLADASQRLLPYWTAELAPRLLSGKNQLIVAHGST
LRALVKFMEDISDAGINKVEIGNAQPIVYTLDDKLTILDKQTL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtggttaaattagtcctgttaaggcatggcgagagcatcgccaatcagaagaatacttat
accggctggtcggatgtgggtttaaccgcagagggtaaggcacaggctgagacagctggg
gaaaaaatcgcgtccacggggatcttgtttgatcatgttcatacgagcgtgctatcgcgg
gcaatcatgacggcatacatcgtgcaagataagatcggccagaactacctgccgatcacg
aaaagttggcggcttaatgagcggcattacggtgccttacgtggtattaacaaggacttg
acgcgcaagctgtttggcccggatcaggttgcaagttggcggcggagtttttccgcacat
ccgccattacttgctaatcctagtcgaacccggcggtaccaccgttatccagccacgatc
atcccgcgcggcgagagccttgccgatgcgagtcaacggttgttaccgtattggacagct
gaactggcaccgcgccttttgtccgggaaaaatcagctcattgtcgctcacggctctact
ttgcgcgccttggtgaagtttatggaagacatcagcgatgctggcatcaacaaggtcgaa
attggaaatgcgcaaccgattgtttacaccttggatgacaagctaaccattctggataag
caaactttataa

DBGET integrated database retrieval system