KEGG   Lactobacillus casei LC2W: LC2W_2835Help
Entry
LC2W_2835         CDS       T01956                                 

Definition
autoinducer-2 (AI-2) kinase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
lce  Lactobacillus casei LC2W
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:lce00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2759402..2760130)
Genome map
AA seq 242 aa AA seqDB search
MTEQYVFENERKDLAEVAREMFMRKNTNVAGGNISVRITPDKDFDYGDIHIKAGKDYLIM
TPTMMSEAWYAKLQPTQILVVDLETGKLIDGVGRLTREINMHEEAYRANDKIRCVYHSHA
EESMFWATAGLDMPNVTEVTEEVGPIRVLPYAPACSKELADTVYNGLQEVGDAAKEHIFL
LNSHGVLITSEDLHHATEILETVEWNAKIAYQQTVFMKLGLLESYQSCGKTTDGMLKEPL
KA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacaatatgtctttgaaaatgagcggaaagatttagctgaagtggcccgcgaa
atgttcatgcggaagaataccaatgttgcaggtggcaacattagcgttcggatcacccct
gacaaggattttgattacggggatattcatattaaagctggcaaagattatctgattatg
acgccaaccatgatgtctgaagcctggtatgccaagttgcaaccaacccaaattttggtg
gttgatcttgaaaccggcaaactgattgacggcgttggtcgtctgacccgtgaaatcaac
atgcatgaagaagcttatcgggccaacgacaagatccgttgtgtctatcattcccatgct
gaagaatccatgttctgggcaacagccggattggatatgccaaatgtcaccgaagttact
gaagaagttggtccgattcgggtactgccatacgcaccagcctgctccaaggaacttgca
gacacggtctacaatggcctgcaggaagtcggagatgcggcaaaagagcacatcttcctc
ttaaacagccatggtgttttgatcacttccgaagacttgcatcatgccacagaaattctg
gaaaccgttgaatggaatgcgaagattgcttatcaacagacggtcttcatgaaactggga
ttgttagaaagctatcagtcctgcggtaaaacaactgatggcatgttgaaggaacctttg
aaagcctag

DBGET integrated database retrieval system