KEGG   Lates calcarifer (barramundi perch): 108874798Help
Entry
108874798         CDS       T04895                                 

Gene name
abhd6
Definition
(RefSeq) monoacylglycerol lipase ABHD6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
lcf  Lates calcarifer (barramundi perch)
Brite
Enzymes [BR:lcf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     108874798 (abhd6)
Peptidases [BR:lcf01002]
 Serine Peptidases
  Family S33
   108874798 (abhd6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Thioesterase Esterase Esterase_phd Abhydrolase_3 Lipase DUF2048 Ndr DUF1057
Motif
Other DBs
NCBI-GeneID: 108874798
NCBI-ProteinID: XP_018518854
Position
Unknown
AA seq 339 aa AA seqDB search
MELGVAKTIMLAGGIVALPVLAFITSLLFWPGALLKAYNWYWRRRLGLVVRYSSSGSYRF
CYSSRGTPGGATPSLLLLHGFSATKDMWLPVVRYLPRHCHLVCVDMPGHEGTSRTSAEDY
SIQGQVGRIHQFVQSIGLDKQPFHLVGTSMGGNVAGVYAAHYPAHLSSVTLICPAGLVYP
TETEFISHLREMEKSQKEESIPLIPTTPQELGNMLKLCCHTPPNLPRPVMRGLLDNRIPN
NGFYREVFMEIVGEKSRHSLQENLHLITAPLQVIWGKEDRVLDVSGAAVLQAALPSCQVE
VLENCGHSVALERPRKAAKLITDFLSAQEVNGGDAKKNS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggagctgggtgttgctaaaacgataatgctagccggaggtattgtggctctgcctgtc
ctcgccttcatcacctccctcctcttctggcctggagcgctgctaaaggcctacaactgg
tactggcgtcgcagactgggcctggtggtccgctactcctccagtggaagttatcgcttc
tgttattccagccgtgggacaccagggggcgccacgccatcactgctgctgctgcatggc
ttctcagccaccaaggacatgtggctgcccgtcgtcaggtacctccccagacactgtcat
ctggtgtgtgtggacatgccgggacacgaggggacaagtcgcaccagcgctgaggactac
agcatccagggtcaggtcggccgcatccaccagtttgtgcagagcatcggtttggataaa
caacccttccacctggttggcacatccatgggcgggaacgtcgcaggggtgtacgctgcc
cactaccccgctcacctgtccagcgtcaccttgatttgcccggcaggtctggtttatccc
acggagacggagttcatcagccacctgagggagatggagaagagtcaaaaggaggagtcg
atccctctgatccccaccacccctcaggagctggggaacatgctgaagctctgctgtcac
accccacccaacctcccccgcccggtcatgcgaggtctccttgacaacaggatccccaac
aacggtttctacagagaggtgttcatggagatcgtcggggagaagtctcgtcactctctg
caggagaacctgcatctgatcacagcgcccctgcaggtcatctgggggaaggaggaccgg
gtgctggatgtttcgggagcagcagtgctgcaggcggcgctgccgagctgccaggtggag
gtgctggaaaactgcggtcactctgtggcgctggagcggccgaggaaagccgccaagctc
atcacagacttcctgtctgcgcaggaagtcaatggaggagatgctaagaaaaattcctaa

DBGET integrated database retrieval system