KEGG   Leptothrix cholodnii: Lcho_0041Help
Entry
Lcho_0041         CDS       T00681                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lch  Leptothrix cholodnii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lcho_0041
   01230 Biosynthesis of amino acids
    Lcho_0041
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lcho_0041
   00030 Pentose phosphate pathway
    Lcho_0041
   00051 Fructose and mannose metabolism
    Lcho_0041
   00052 Galactose metabolism
    Lcho_0041
  Energy metabolism
   00680 Methane metabolism
    Lcho_0041
Enzymes [BR:lch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Lcho_0041
Protein phosphatases and associated proteins [BR:lch01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Lcho_0041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(45695..46909)
Genome map
AA seq 404 aa AA seqDB search
MNPRKILVAQGGGPTAVINQSLAGVVLEARRHRGVELVYGARHGVRGIVNEDLVDLTQET
SHNLEMVAATPASALGSTRDKPDIKYCQEIFKVLQAHEIGQFYYIGGNDSSDTVRIVSEQ
AQAANYALRCIHIPKTIDNDLVGNDHTPGFPSAARFVAQAFAGANLDNAALPGVYVGVVM
GRHAGFLTAASALGKKFADDGPHLIYVPERVFEVEKFLADVKATYERFGRCVIAVSEGIH
DAAGTPIISTLAKELEHDAHGNVQLSGTGALADLLCEEIKQRLGIKRVRGDTFGYLQRSF
IGCVSDVDQREAREVGEKAVQFAMWGGSDGSVAIKRAGYYAADYELLPLSAVAGKTRTME
DEFIAPNGTDVTDAFRLYLRPLLGSGMPDAYRLRPNPVAKVLNR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaacccccgcaagatcctggtcgcccaaggcggcggcccgaccgccgtgatcaaccag
tcgctcgccggcgtggtgctcgaagcgcgccgccaccgcggcgtcgagctggtctacggc
gcccgccacggcgtgcgcggcatcgtcaacgaagacctggtcgacctgacacaggagacc
agccacaacctcgagatggtggctgccacgcccgcctcggcgctcggctcgacgcgcgac
aagcccgacatcaaatactgccaggagatcttcaaggtgctgcaggcgcacgagatcggg
cagttctattacatcggcggcaacgactcgtcggacaccgtgcgcatcgtcagcgagcag
gcccaagcggccaattacgcgctgcgctgcatccacatccccaagacgatcgacaacgac
ctggtcggcaatgaccacacgcccggtttcccgagcgcggcgcgtttcgtcgcccaggct
tttgccggcgccaacctcgacaacgcggcgctgccgggcgtctacgtcggcgtggtgatg
ggccggcatgcgggcttcctgaccgctgcgtcggcgctgggcaagaagttcgccgacgac
ggcccgcacctgatctacgtgcccgagcgggtgttcgaggtcgagaagttcctggccgac
gtcaaggccacctacgagcgcttcggccgctgcgtgatcgcggtcagcgaaggcatccac
gacgccgccggcacgcccatcatcagcacgctggccaaggagctggagcacgacgcccac
ggcaacgtgcagctctcgggcaccggcgcgctggccgacctgctgtgcgaggagatcaag
cagcgcctgggcatcaagcgcgtgcgcggcgacaccttcggctacctgcagcgctcgttc
atcggctgtgtgtccgacgtcgaccagcgcgaggcccgcgaggtcggcgagaaggcggtg
cagttcgcgatgtggggcggcagcgacggctcggtggcgatcaagcgcgccggctactac
gccgccgactacgagctgctgccgctgtcggcggtggccggcaagacgcgcacgatggaa
gacgagttcatcgcgcccaacggcaccgacgtgacggatgcgttcaggctctacctgcgg
ccgctgctgggctcgggcatgccggatgcgtaccggctgcggcccaatccggtggcgaag
gtgctgaaccgctga

DBGET integrated database retrieval system