KEGG   Leptothrix cholodnii: Lcho_0517Help
Entry
Lcho_0517         CDS       T00681                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lch  Leptothrix cholodnii
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lch00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lch00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
560774..562315
Genome map
AA seq 513 aa AA seqDB search
MALHQLPDVDAALAWLRARLGDAAELRTDSRSVRAGEAFIAWPGHAADGRAYVGAALAAG
AAACLIEADGAAAFGFDDERIAALPGLKAATGELAHRWYGEPGRRLALIATSGTNGKTST
AWWTAQALSLAGQRCGVIGTLGVGEPPSRVHPDAQVHATGLTTPDPLTLHRSLRDFADAG
FAACAIEASSIGIVEHRLDAAPIRVALYTNFTPDHLDYHGDMVAYWLAKRALFDWPGLQA
AAINVDDAQGAVLADELAARGDLDLWTYALHRDARLRATGLHYVDGGLAFTLHEGETDVA
VHTHLIGAYNASNVLAVIGGLRALGLPLAQAAALAAEFTSVPGRMHRVRPASPTGAVPQV
VVALPQVVVDYAHTPDALDKALSALRPVAHAQGGRLVCVFGCGGNRDATKRPQMGAIAAQ
LADAVCVTSDNPRLEEPQAIVDQILAGCAGAAHVRAEVDRTRAIEQVLAQAAPEDVVLIA
GKGHEDYQDIGGVKRPFSDIDVATAALQRRVTA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcatcagctgcccgacgtcgatgccgcgctggcgtggctgcgggcgcggctc
ggcgacgccgccgagctgcgcaccgacagccgcagcgtgcgcgccggcgaggccttcatc
gcctggccgggtcatgccgccgatggccgcgcctacgtcggcgcggcgctggcggccggc
gccgcggcctgcctgatcgaggccgacggcgccgcggccttcggtttcgatgacgagcgc
atcgccgcgctgccgggtctgaaggccgccaccggcgagctggcgcaccgctggtacggc
gagcccggccggcgcctggcgctgatcgccaccagtggcaccaacggcaagacctcgacc
gcctggtggaccgcgcaggcgctgagcctggccggccagcgctgcggcgtgatcggcacg
ctgggcgtgggcgagccgcccagccgcgtccatcccgacgctcaggtgcacgccaccggc
ctgaccacgcccgatccgctgacgctgcaccgcagcctgcgcgatttcgccgacgccggt
ttcgccgcctgcgcgatcgaggcctcgtcgatcggcatcgtcgaacaccggctcgacgcg
gcgccgatccgggtcgcgctctacaccaacttcacgcccgaccacctcgactaccacggc
gacatggtggcctactggctggccaagcgcgcgctgttcgactggccgggcctgcaggct
gccgccattaacgtcgacgacgcgcagggcgccgtgctggccgacgaactggccgcgcgt
ggcgatctcgacctctggacctacgcgctgcatcgcgatgcgcgcctgcgtgcgaccggc
ctgcattacgtcgacggcggcctggccttcacgctgcacgagggcgaaaccgacgtggcg
gtgcacacccacctgatcggcgcctacaacgcctccaacgtgctggccgtgatcggcggc
ctgcgcgcgctcggcctgccgctggcgcaggcggcggcgctggcggccgaattcacctcg
gtgcccgggcgcatgcacagagtccggccggcaagcccgaccggcgctgtgccgcaggtc
gtggtcgctctaccgcaggtggtcgtcgattacgcccacacgcccgatgcgctcgacaag
gccctgagcgccctgcggccggtcgcgcatgcgcaaggcggccgactggtgtgcgtgttc
ggctgcggcggcaaccgcgatgcgaccaagcgccctcagatgggcgccatcgccgcgcag
ctggccgacgcggtctgcgtcaccagcgacaacccgcggctcgaagaaccgcaagccatc
gtcgaccagatcctggccggctgtgcaggcgcggcgcacgtgcgcgccgaggtcgaccgc
acacgcgccatcgaacaggtgctggcgcaggcagcgcccgaggacgtggtgctgatcgcc
ggcaagggccacgaggactaccaggacatcggcggcgtcaagcggccgttttccgacatc
gacgtggccacggccgcgttgcaacgccgggtgacggcatga

DBGET integrated database retrieval system