KEGG   Leptothrix cholodnii: Lcho_0676Help
Entry
Lcho_0676         CDS       T00681                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
lch  Leptothrix cholodnii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Lcho_0676
Enzymes [BR:lch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Lcho_0676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
730799..731287
Genome map
AA seq 162 aa AA seqDB search
MHRLYIGLGANLGDSRATLEAACAELAVLPDCRWVARSGCYRSAPVDTSGPDFLNAVVAL
DCHLDRIDGPLRVLRALQAIELGHGRERPFRYAPRTLDLDLLLYGDVVLDSPELTVPHPR
LHLRAFVLRPLLELAPDLLLPGIGPARNCLPAVLDQAIERLA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgcatcggctctacatcggcctgggcgccaatctcggcgacagccgtgccacgctggaa
gccgcttgcgcagagctggcggtgttgcccgattgccgctgggtggcgcgctcgggctgc
taccgcagtgcaccggtcgacaccagcgggccggattttctcaacgccgtggtggcgctc
gactgccacctcgatcgcatcgacgggccgctgcgggtgctgcgcgcgctgcaggcgatc
gagctcggccacggccgcgagcggcctttccgctacgcgccgcgcaccctcgatctcgac
ctgctgctctacggcgacgtggtgctcgacagccccgagctgaccgtgccgcatccgcgt
ctgcacctgcgggcgttcgtgctgcggcccctgctcgaactggcgcctgacctgctgctg
cccggcatcggcccggcccgcaactgcctgccggccgtgctcgatcaggcgatcgaacgc
ctggcctga

DBGET integrated database retrieval system