KEGG   Leptothrix cholodnii: Lcho_0702Help
Entry
Lcho_0702         CDS       T00681                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
lch  Leptothrix cholodnii
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:lch00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Lcho_0702
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Lcho_0702
Enzymes [BR:lch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Lcho_0702
Two-component system [BR:lch02022]
 CheA family
  CheA-CheYBV
   Lcho_0702
Bacterial motility proteins [BR:lch02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Lcho_0702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
750830..751984
Genome map
AA seq 384 aa AA seqDB search
MPKTRVVVVDDSALVRSLLAEIINRQSDMECIGAASDPIAAREMIRSLDPDVITLDVEMP
RMDGIDFLAKLMRLRPMPVVMVSTLTERGAEVTLRALEFGAIDFVAKPKIGVANGLRLLA
QEITEKVRIAAGARVTKLAPAPAHAPPRAPSHGHAAHGSQGPSGASSAPETAPPTGPVPS
PLGRLSTEKLIFIGASTGGTEATREVLCGLPADAPAILITQHMPPGFTTSYAARLNNLCR
IAVKEAADGERILPGHAYLAPGGFHLSVERSGANYIARVRDGDPVNRHRPSVEVLFQSAA
RVAGRNAIGVMLTGMGADGARAMKEMRDAGAYNVAQDEASCVVFGMPREAIAAGACQEVL
PVKRIAQHLIEHLRSTAGAALSRV
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagacccgcgtggtggtggtcgacgattcggcgctggtgcgcagcctgctggcc
gagatcatcaatcgccagagcgacatggagtgcatcggcgcggccagcgacccgatcgcc
gcgcgcgagatgatccgcagcctcgacccggacgtgatcacgctcgacgtcgagatgccg
cgcatggacggcatcgacttcctcgccaagctgatgcgcctgcgaccgatgccggtggtg
atggtctcgacgctgaccgagcgaggcgccgaagtgaccttgcgtgcgctcgaattcggc
gcgatcgacttcgtcgccaagcccaagatcggcgtcgccaacggcctgcgtctgctggcg
caggaaatcaccgagaaggtgcgcatcgccgccggtgcgcgggtcaccaagctggcgccg
gcaccggcccatgcgcccccgcgtgcgccatcgcacggccacgctgcacacgggtcgcag
gggccttccggcgcatcgtctgcgccagagaccgcgccgccgaccggccccgtgccgagc
ccgttggggcggctgtcgaccgaaaagctgatcttcatcggcgcctccaccggcggcacc
gaagccacccgcgaggtgctgtgcggcctgcccgccgacgcgccggcgatcctgatcacg
cagcacatgccacccggcttcaccaccagctacgcggcacggctcaacaacctgtgccgc
atcgcggtgaaggaggccgcggatggcgagcgcatcctgcccggccatgcctatctggcg
ccgggcggatttcacctgtcggtggagcgctcgggcgccaactacatcgcccgggtgcgc
gacggcgatccggtcaaccggcatcggccgagcgtcgaggtgctgttccagtcggctgcg
cgggtggccgggcgcaacgcgatcggcgtcatgctgaccggcatgggtgccgacggtgcc
cgcgcgatgaaggaaatgcgcgacgccggtgcctacaacgtcgcgcaggacgaggccagc
tgcgtcgtcttcggcatgccgcgcgaggcgattgcggccggcgcctgccaggaggtgctg
ccggtcaagcgcattgcccagcacttgatcgaacatctgcgcagcaccgccggtgcggcc
ttgagccgggtctga

DBGET integrated database retrieval system