KEGG   Leptothrix cholodnii: Lcho_0717Help
Entry
Lcho_0717         CDS       T00681                                 

Definition
D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
Orthology
K00058  
D-3-phosphoglycerate dehydrogenase [EC:1.1.1.95]
Organism
lch  Leptothrix cholodnii
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lcho_0717
   01230 Biosynthesis of amino acids
    Lcho_0717
  Energy metabolism
   00680 Methane metabolism
    Lcho_0717
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lcho_0717
Enzymes [BR:lch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     Lcho_0717
Exosome [BR:lch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Lcho_0717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(765827..766750)
Genome map
AA seq 307 aa AA seqDB search
MSAIKPTFLVTGSDLAAAALALLHDHEVVYAGKTPTEDHIVALCRQHDPVAIIVRYSKVG
AAAMDAAPSLKVISKHGSGTDTIDKSAAAARGIQVVAAAGANAAAVAEHALALLMACAKS
VVTLDARMRQGHWDKATHKSVELEGRTVGLIGLGAIGQRFARMADAMGMRVLGFDPFAKE
LPDYIERAELATIWRESDVISLHCPLTPENAKLLNAQTLGACKKGVIVVNTARGGLIDEP
ALLAAIRSGQVGSAGLDSFAAEPMTAPHPFHGEARITLSPHIGGVTADAYVKMGVAAAKN
ALAVLQG
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgatcaagccaaccttcctcgtcacgggcagcgatctcgccgccgcggcgctg
gcgctgctgcacgaccacgaggtcgtctatgccggcaagacgccgaccgaggatcacatc
gtcgcgctgtgccggcagcacgacccggtggcgatcatcgtgcgctacagcaaggtgggc
gccgccgcgatggacgccgcgccaagcctgaaggtgatctccaagcacggcagcggcacc
gacacgatcgacaagagcgccgccgctgcgcgtggcatccaggttgtcgcggcggccggc
gccaacgcggcggccgtcgccgagcatgcgctggcgctgttgatggcctgcgccaagtcg
gtggtcacgctcgatgcccgcatgcgtcagggccactgggacaaggcaacccacaagagc
gtcgaactcgaaggccgcacggtcggtttgatcggactcggtgcgatcggccaacgcttc
gcgcgcatggccgacgcgatgggcatgcgcgtgctcggcttcgacccttttgccaaggag
ctgccggactacatcgaacgcgccgagctggcgacgatctggcgcgagtcggacgtgatc
tcgctgcactgcccgctgacgcccgaaaacgcgaagctgctgaatgcgcagacgctgggc
gcctgcaagaagggcgtgatcgtcgtcaacaccgcacgtggcggcctgatcgacgagcca
gcgctgctggcggccatccgcagcgggcaggtgggcagcgcggggttggacagcttcgcc
gccgaaccgatgacggcgccgcatcccttccacggcgaagcgcgcatcacgctgagtccg
cacatcggcggcgtcaccgccgatgcctacgtcaagatgggcgtggccgcggcgaagaac
gcactggccgtgctgcagggctga

DBGET integrated database retrieval system