KEGG   Leptothrix cholodnii: Lcho_0717Help
Entry
Lcho_0717         CDS       T00681                                 

Definition
D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
Orthology
K00058  
D-3-phosphoglycerate dehydrogenase [EC:1.1.1.95]
Organism
lch  Leptothrix cholodnii
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Serine biosynthesis, glycerate-3P => serine
Class
Metabolism; Overview; Carbon metabolism [PATH:lch01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lch01230]
Metabolism; Energy metabolism; Methane metabolism [PATH:lch00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lch00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(765827..766750)
Genome map
AA seq 307 aa AA seqDB search
MSAIKPTFLVTGSDLAAAALALLHDHEVVYAGKTPTEDHIVALCRQHDPVAIIVRYSKVG
AAAMDAAPSLKVISKHGSGTDTIDKSAAAARGIQVVAAAGANAAAVAEHALALLMACAKS
VVTLDARMRQGHWDKATHKSVELEGRTVGLIGLGAIGQRFARMADAMGMRVLGFDPFAKE
LPDYIERAELATIWRESDVISLHCPLTPENAKLLNAQTLGACKKGVIVVNTARGGLIDEP
ALLAAIRSGQVGSAGLDSFAAEPMTAPHPFHGEARITLSPHIGGVTADAYVKMGVAAAKN
ALAVLQG
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgatcaagccaaccttcctcgtcacgggcagcgatctcgccgccgcggcgctg
gcgctgctgcacgaccacgaggtcgtctatgccggcaagacgccgaccgaggatcacatc
gtcgcgctgtgccggcagcacgacccggtggcgatcatcgtgcgctacagcaaggtgggc
gccgccgcgatggacgccgcgccaagcctgaaggtgatctccaagcacggcagcggcacc
gacacgatcgacaagagcgccgccgctgcgcgtggcatccaggttgtcgcggcggccggc
gccaacgcggcggccgtcgccgagcatgcgctggcgctgttgatggcctgcgccaagtcg
gtggtcacgctcgatgcccgcatgcgtcagggccactgggacaaggcaacccacaagagc
gtcgaactcgaaggccgcacggtcggtttgatcggactcggtgcgatcggccaacgcttc
gcgcgcatggccgacgcgatgggcatgcgcgtgctcggcttcgacccttttgccaaggag
ctgccggactacatcgaacgcgccgagctggcgacgatctggcgcgagtcggacgtgatc
tcgctgcactgcccgctgacgcccgaaaacgcgaagctgctgaatgcgcagacgctgggc
gcctgcaagaagggcgtgatcgtcgtcaacaccgcacgtggcggcctgatcgacgagcca
gcgctgctggcggccatccgcagcgggcaggtgggcagcgcggggttggacagcttcgcc
gccgaaccgatgacggcgccgcatcccttccacggcgaagcgcgcatcacgctgagtccg
cacatcggcggcgtcaccgccgatgcctacgtcaagatgggcgtggccgcggcgaagaac
gcactggccgtgctgcagggctga

DBGET integrated database retrieval system