KEGG   Leptothrix cholodnii: Lcho_0729Help
Entry
Lcho_0729         CDS       T00681                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lch  Leptothrix cholodnii
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Lcho_0729 (gmk)
Enzymes [BR:lch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Lcho_0729 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
777448..778077
Genome map
AA seq 209 aa AA seqDB search
MKIMEFPGNLYVVAAPSGAGKSSLVKALLELDARLMVSVSHTTRKPRGQEQDGREYWFIP
EPAFRAMIAHGDFFEWAEVHGNLYGTSRAAIEARLKAGEDVVLEIDFQGALQIKQLFPMA
VLIFILPPSWSELRQRLLRRGEDAGEVIEQRMVNARHEVAQARHFDYIVVNALFETALFD
LKTIVHAQRLKYAAQRRSRPAVFDALQLS
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcatggaatttcccggcaatctctatgtcgtcgcagcgccttccggggcgggc
aaatcgagcctggtcaaggccctgctggaactggatgcgcgcctgatggtgtcggtctcg
cacaccacgcgcaagccgcgtggccaggagcaggacggccgcgaatactggttcatcccg
gagccggcgttccgcgccatgatcgcgcacggcgactttttcgagtgggccgaggtgcac
ggcaacctgtacggcacctcccgcgcagcgatcgaggcccgcctgaaggcgggcgaggat
gtggtgctggagatcgacttccagggcgctctgcagatcaagcagctgttcccgatggcg
gtgctgatcttcatcctgccgccgtcgtggagcgagcttcgtcagcgtctgctgcggcgc
ggcgaggatgccggcgaggtgatcgagcagcgcatggtcaacgcccgtcacgaggtggcg
caggcgcggcatttcgactacatcgtcgtcaacgcgctgttcgagacggcgttgttcgac
ctcaagaccatcgtgcacgcacaacggttaaaatacgcggctcagcgccgcagccgcccg
gctgtgttcgacgcgctgcaactgtcctga

DBGET integrated database retrieval system