KEGG   Leptothrix cholodnii: Lcho_0807Help
Entry
Lcho_0807         CDS       T00681                                 

Definition
(GenBank) glycoside hydrolase family 3 domain protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lch  Leptothrix cholodnii
Pathway
lch00520  Amino sugar and nucleotide sugar metabolism
lch01100  Metabolic pathways
lch01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Lcho_0807
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Lcho_0807
Enzymes [BR:lch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Lcho_0807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C
Motif
Other DBs
NCBI-ProteinID: ACB33079
JGI: Lcho0807
UniProt: B1Y1A2
Position
complement(869511..871175)
Genome map
AA seq 554 aa AA seqDB search
MKDILRQAPFDLDEEQVEWVCNTIDGLTLREKIGQLINLQILPGDEEAIELVERHQLGAV
TVINFSDPDACRSVIDAARKASRIRPLVSADLEGGVTSGHLTTTFPNQLGCAAAACLDTY
GEALRMLSAELASLGVNWTFSPVLDVNQKFQSAIVGTRSYGSNPDLIAQLAGLHIQVFQD
HGIATTAKHWPGEGFDDRDQHLVTTINPMTVEEWTAVFGQLYARAIDAGVLSVMSAHIAF
PDYLRRAGLSSIELYRPASISRHLNQTLLREQLQFNGLIVSDATLMGGLESWGSRRQWLP
EVIENGCDMILFSPSVDTDIETLLEAAGSGALSQQRIDAALARVLGLKARMNLHRAEAAA
PVDAGLIGSPAHKAVMARLSDLSPTLVKDVHGIVPLDHKVRKILMFKEENVHPLGGDESF
RIQLDRLLAAEGFEVHVFDPQTDDLSICKAHDLILYVFAQESQLMKSRLFIDWARLHGGT
MPGMSRLWWDTPTVFISFGHPYYLYDAPRVPCLINAYTPTPDIQRAVVDKLLGRSRFTGK
SPVDAFCGLADAHF
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacatcctgcgccaggcgccattcgatctggacgaggaacaggtcgagtgggtc
tgcaacaccatcgacggcctgacgctgcgagagaagatcgggcagctgatcaacctccag
atcctgcccggtgacgaagaggcgatcgagctggtcgagcggcaccagctcggcgcggtc
accgtcatcaatttctcggatcccgatgcctgtcgcagcgtcatcgacgcggcacgcaag
gcctcgcgcatccgtccgctggtatcggccgacctcgaaggcggcgtcaccagcgggcac
ttgacgaccacgttcccgaatcagctcggctgtgccgccgccgcctgcctggatacctat
ggcgaggctctgcggatgctgtcggcggaactcgcctcgctgggcgtgaactggaccttc
tcgccggtcctggacgtcaaccagaaattccagagcgcgatcgtcggaacccgctcctac
ggcagcaatccggacctgatcgcgcagttggccggactgcacatccaggtcttccaggac
cacggcatcgccaccaccgccaagcactggcccggcgagggtttcgacgaccgggaccag
cacctcgtcacgaccatcaacccgatgacggtcgaggaatggacggcggtgttcgggcag
ttgtatgcccgcgccatcgacgcgggcgtgctgtcggtcatgtcggcgcacatcgcgttt
ccggactatctgcgtcgcgccggtctgtcgtcgatcgagctctatcgaccggcctcgatc
tcgcggcacctgaaccagacgctgctgcgcgagcagctgcagttcaacggtctgatcgtc
tccgacgccacgctgatgggcggcctcgaaagctggggcagccgccggcaatggttgccc
gaggtgatcgagaacggctgcgacatgatcctgttctcgccgtcggtcgacaccgacatc
gagaccttgctggaagccgccggcagcggcgcgctcagccagcagcgcatcgacgcggca
ctggcgcgcgtgctgggactcaaggcccgcatgaacctgcaccgtgccgaggccgcagcg
ccagtcgacgccggcctgatcggctcgccggcccacaaggcggtgatggcgcgtctgtcg
gacctgtcgcccaccctcgtcaaggacgtgcacggcatcgtgccgctggaccacaaggtc
cgcaagatcctgatgttcaaggaggaaaacgtccatccgctgggcggcgatgaatcgttc
cgcatccagctggatcggcttctcgcggccgaaggtttcgaggtccatgtcttcgacccg
cagaccgacgacctgagcatctgcaaggcacacgacctgatcctctacgtgttcgcgcag
gaatcgcagctcatgaagtcgaggctcttcatcgactgggcccggctgcacggcggcacg
atgcccggcatgtcacggctctggtgggacacgcccaccgtcttcatctccttcgggcat
ccgtactacctgtacgacgcgccgcgggttccctgcctgatcaacgcctacacgccgacg
cccgacatccagcgggccgtcgtcgacaagttgctgggacgcagccgtttcacgggcaag
agtccggtcgacgcgttctgcggcctggctgacgcgcacttctga

DBGET integrated database retrieval system