KEGG   Leptothrix cholodnii: Lcho_1190Help
Entry
Lcho_1190         CDS       T00681                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
lch  Leptothrix cholodnii
Pathway
lch00071  Fatty acid degradation
lch00280  Valine, leucine and isoleucine degradation
lch00281  Geraniol degradation
lch00310  Lysine degradation
lch00360  Phenylalanine metabolism
lch00362  Benzoate degradation
lch00380  Tryptophan metabolism
lch00410  beta-Alanine metabolism
lch00627  Aminobenzoate degradation
lch00640  Propanoate metabolism
lch00650  Butanoate metabolism
lch00903  Limonene and pinene degradation
lch00930  Caprolactam degradation
lch01100  Metabolic pathways
lch01110  Biosynthesis of secondary metabolites
lch01120  Microbial metabolism in diverse environments
lch01130  Biosynthesis of antibiotics
lch01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Lcho_1190
   00650 Butanoate metabolism
    Lcho_1190
  Lipid metabolism
   00071 Fatty acid degradation
    Lcho_1190
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Lcho_1190
   00310 Lysine degradation
    Lcho_1190
   00360 Phenylalanine metabolism
    Lcho_1190
   00380 Tryptophan metabolism
    Lcho_1190
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Lcho_1190
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Lcho_1190
   00281 Geraniol degradation
    Lcho_1190
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Lcho_1190
   00627 Aminobenzoate degradation
    Lcho_1190
   00930 Caprolactam degradation
    Lcho_1190
Enzymes [BR:lch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Lcho_1190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ACB33459
JGI: Lcho1190
UniProt: B1Y4M0
Position
1275801..1276577
Genome map
AA seq 258 aa AA seqDB search
MTEHPILTETVGRVGVITLNRPRQLNALNDALMDALGAALLAFDADEAIGVIVVTGGPKA
FAAGADIAAMVDWTYMDVYRSEFITRNWETIRRVRKPVIAAVAGFAMGGGCELALSCDIV
IAAESAKFALPEIKLALLPGAGGTQRLPRAIGKAKAMDMCLSARTLDATEADRYGLVSRV
VPDEQLMATSLALATTIAGYSLPALMALKESVNRAWEGSLAEGIAYERRELHARFASADA
HEGMRAFLDKRKPEFKHR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacaccccatcctcaccgagaccgtcggccgcgtcggcgtcatcacgctgaac
cggccccgccagctcaacgcgctcaacgacgccctgatggacgcgctgggtgccgcgctg
ctggccttcgatgcggacgaggccatcggcgtcatcgtcgtcaccggcggccccaaggcc
ttcgcggccggcgccgacatcgccgcgatggtcgactggacctacatggacgtctaccgc
agcgagttcatcacccgcaactgggaaaccatccgccgcgtgcgcaagccggtgatcgcc
gcggtggccggcttcgcgatgggcggcggctgcgagctggcgctgtcgtgcgacatcgtg
atcgccgccgagagcgcgaagttcgcgctgcccgagatcaagctcgcgctgctgccgggt
gccggtggcacgcagcgcctgccgcgcgcgatcggcaaggccaaggcgatggacatgtgc
ctgtcggcccgcaccctcgatgccaccgaggccgatcgctacgggctggtctcgcgcgtg
gtgcccgacgagcagctgatggccaccagcctggcgctcgccaccaccatcgccggctac
tcgctgccggcgctgatggcgctgaaggagtcggtcaaccgggcctgggagggctcgctc
gccgaaggcatagcctacgagcggcgcgagctgcacgcgcgctttgctagcgccgacgcc
cacgaaggcatgcgcgccttcctcgacaagcgcaagcccgaattcaagcaccgctga

DBGET integrated database retrieval system