KEGG   Leptothrix cholodnii: Lcho_1499Help
Entry
Lcho_1499         CDS       T00681                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lch  Leptothrix cholodnii
Pathway
lch00010  Glycolysis / Gluconeogenesis
lch00051  Fructose and mannose metabolism
lch00562  Inositol phosphate metabolism
lch01100  Metabolic pathways
lch01110  Biosynthesis of secondary metabolites
lch01120  Microbial metabolism in diverse environments
lch01130  Biosynthesis of antibiotics
lch01200  Carbon metabolism
lch01230  Biosynthesis of amino acids
Module
lch_M00002  Glycolysis, core module involving three-carbon compounds
lch_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lcho_1499
   00051 Fructose and mannose metabolism
    Lcho_1499
   00562 Inositol phosphate metabolism
    Lcho_1499
Enzymes [BR:lch01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Lcho_1499
Exosome [BR:lch04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Lcho_1499
  Exosomal proteins of bladder cancer cells
   Lcho_1499
  Exosomal proteins of melanoma cells
   Lcho_1499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACB33767
JGI: Lcho1499
UniProt: B1Y825
Position
1585147..1585893
Genome map
AA seq 248 aa AA seqDB search
MDTNRKLVVGNWKMHGSHVANAELLQGVLAARPFGCDVAVCAPFPYLSEVAVTLAGSPLL
WGAQDCSAHEQGAYTGEVSAAMLAEFGCRYVIVGHSERRAYHAESDQLVADKAKAALARG
ITPIVCVGETLAQREAGETATVVKRQLSVVIHALTHCIGEIVVAYEPVWAIGTGRTATPE
QAQEVHALLRAQLAAATPHAAQMKLLYGGSVKPDNADSLFAQPDIDGGLIGGAALKAADF
VAIVRAAG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggacacgaatcgcaaactggtggtgggcaactggaagatgcatggcagccacgttgcc
aatgccgagttgctgcaaggcgtgctggccgctcggccctttggctgcgacgtggcggtg
tgtgcgccgttcccctatctgtccgaggtggcggtgacgctggccggcagccctcttctg
tggggtgcgcaggattgttcggcccacgagcagggcgcctacaccggcgaggtgtcggct
gcgatgctggccgagtttggctgccgctatgtcatcgtcggccactcggagcggcgcgcc
tatcacgccgaatccgaccagctggtggccgacaaggccaaggccgcgctggcccgaggc
atcacgccgatcgtctgcgtcggcgagacgctggcgcagcgtgaggccggtgaaacggca
acggtggtcaagcgccagctctcggtcgtgatccacgccctgacgcactgcatcggcgaa
atcgtggttgcctacgagccggtctgggcgatcggcaccggtcgcacggccaccccggaa
caggctcaggaagtgcatgccctgctgcgcgcccagctggctgccgcaacgccgcacgcc
gcgcagatgaaattgctctatggcggcagcgtcaagcctgacaacgccgactcgctgttc
gctcagcccgacatcgacggtggcctgatcggtggcgcggcgctcaaggcggccgacttc
gtcgccatcgtgcgcgcagccggctga

DBGET integrated database retrieval system