KEGG   Leptothrix cholodnii: Lcho_1499Help
Entry
Lcho_1499         CDS       T00681                                 

Definition
(RefSeq) Triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lch  Leptothrix cholodnii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lcho_1499
   01230 Biosynthesis of amino acids
    Lcho_1499
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lcho_1499
   00051 Fructose and mannose metabolism
    Lcho_1499
   00562 Inositol phosphate metabolism
    Lcho_1499
Enzymes [BR:lch01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Lcho_1499
Exosome [BR:lch04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Lcho_1499
  Exosomal proteins of bladder cancer cells
   Lcho_1499
  Exosomal proteins of melanoma cells
   Lcho_1499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1585147..1585893
Genome map
AA seq 248 aa AA seqDB search
MDTNRKLVVGNWKMHGSHVANAELLQGVLAARPFGCDVAVCAPFPYLSEVAVTLAGSPLL
WGAQDCSAHEQGAYTGEVSAAMLAEFGCRYVIVGHSERRAYHAESDQLVADKAKAALARG
ITPIVCVGETLAQREAGETATVVKRQLSVVIHALTHCIGEIVVAYEPVWAIGTGRTATPE
QAQEVHALLRAQLAAATPHAAQMKLLYGGSVKPDNADSLFAQPDIDGGLIGGAALKAADF
VAIVRAAG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggacacgaatcgcaaactggtggtgggcaactggaagatgcatggcagccacgttgcc
aatgccgagttgctgcaaggcgtgctggccgctcggccctttggctgcgacgtggcggtg
tgtgcgccgttcccctatctgtccgaggtggcggtgacgctggccggcagccctcttctg
tggggtgcgcaggattgttcggcccacgagcagggcgcctacaccggcgaggtgtcggct
gcgatgctggccgagtttggctgccgctatgtcatcgtcggccactcggagcggcgcgcc
tatcacgccgaatccgaccagctggtggccgacaaggccaaggccgcgctggcccgaggc
atcacgccgatcgtctgcgtcggcgagacgctggcgcagcgtgaggccggtgaaacggca
acggtggtcaagcgccagctctcggtcgtgatccacgccctgacgcactgcatcggcgaa
atcgtggttgcctacgagccggtctgggcgatcggcaccggtcgcacggccaccccggaa
caggctcaggaagtgcatgccctgctgcgcgcccagctggctgccgcaacgccgcacgcc
gcgcagatgaaattgctctatggcggcagcgtcaagcctgacaacgccgactcgctgttc
gctcagcccgacatcgacggtggcctgatcggtggcgcggcgctcaaggcggccgacttc
gtcgccatcgtgcgcgcagccggctga

DBGET integrated database retrieval system