KEGG   Leptothrix cholodnii: Lcho_1589Help
Entry
Lcho_1589         CDS       T00681                                 

Definition
imidazoleglycerol-phosphate dehydratase (EC:4.2.1.19)
Orthology
K01693  
imidazoleglycerol-phosphate dehydratase [EC:4.2.1.19]
Organism
lch  Leptothrix cholodnii
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Lcho_1589
  Amino acid metabolism
   00340 Histidine metabolism
    Lcho_1589
Enzymes [BR:lch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.19  imidazoleglycerol-phosphate dehydratase
     Lcho_1589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1687705..1688316
Genome map
AA seq 203 aa AA seqDB search
MNEATMAAPRVAEVQRNTNETRISVRINLDGSGVSKLATGIGFFDHMLDQIARHGMMDIE
VAADGDLHIDGHHTVEDVGITLGLAVAKAVGDKKGITRYGHSYVPLDEALSRVVVDFSGR
PGLEMDVHFSAGMIGGLDTQLIYEFFQGFVNHALVSLHIDNLKGRNAHHQAETIFKAFGR
ALRMALTPDPRSAGVIPSTKGSL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagcaacgatggccgccccgcgcgtggccgaagtccagcgcaacaccaacgag
acgcgcatcagcgtgcgcatcaacctcgacggcagcggcgtttccaagctcgccaccggc
atcggtttcttcgaccacatgctcgaccagatcgcccgccacggcatgatggacatcgag
gtggccgctgacggcgacctgcacatcgacggtcatcacacggtcgaggacgtcggcatc
acgctcggccttgcggtggccaaggcagtcggcgacaagaagggcatcacccgttacggc
cacagctacgtgccgctggacgaagcgctgtcgcgcgtggtggtcgatttttcgggccgc
cccggcctggagatggacgtgcatttcagcgccggcatgatcggcgggctcgacacccag
ctgatctacgagttcttccagggtttcgtgaaccacgcgctggtgagcctgcacatcgac
aacctcaagggccgcaacgcccaccaccaggccgagacgatcttcaaggccttcggccgc
gcgttgcgcatggcgctgacgcccgatccgcgctcggccggggtgatcccgtcgaccaaa
gggagcctctga

DBGET integrated database retrieval system