KEGG   Leptothrix cholodnii: Lcho_1647Help
Entry
Lcho_1647         CDS       T00681                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (EC:2.3.1.61)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lch  Leptothrix cholodnii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lcho_1647
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lcho_1647
   00020 Citrate cycle (TCA cycle)
    Lcho_1647
   00620 Pyruvate metabolism
    Lcho_1647
Enzymes [BR:lch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Lcho_1647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1754941..1756605
Genome map
AA seq 554 aa AA seqDB search
MALIEVKVPDIGDFKDVAIIELLVKPGDTVKAEQSLLTVESDKASMEIPSSHAGVVKDLK
VALGDKINEGTVVLTLEVAGAAAPAPAPAAAAAVPAPAPAAPAAAPVAAPAAAAAGPIEI
FVPDIGDFDSVAVIELLVKPGDTVKAEQSLITVESDKASMEIPSSHAGVIKELKVKLGDK
VSKGSLVAIIEGAAGAAPAAAAPAPAAAAAPAAAPVAAAAAVVAAPAAASVPAHDPTVLN
LSLPHASPSIRKFARELGVPLAEVKGSGPKGRITEVDVQGFVKGVMAGTAQTAAQKAKAP
APAAAGGGEAFPGLLAWPKVDFAKFGPVERKDLSRIKKISGANLHRNWVIIPHVTNHDDA
DITDLEAFRVATNKENEKSGVKVTMLAFMIKAAVAALKKFPEFNASLDGDTLVLKNYFHI
GFAADTPNGLMVPVIKDADKKGIFQISTEMGELAKKARDGKLGPAEMSGGCFSISSLGGI
GGRYFTPIINAPEVAIMGVCKSAIEPKWDGKAFQPRLMLPLSLSWDHRVIDGAAAARFNV
YFASLLADFRRIVL
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcattgattgaagtgaaggtccccgacatcggggatttcaaggacgtcgcgatcatc
gaactgctggtcaagccgggtgacaccgtcaaggccgagcagagcctgctcaccgtcgag
agcgacaaggcctcgatggagatccccagctcgcacgccggcgtggtcaaggacctcaag
gtcgccctgggcgacaagatcaacgaaggcaccgtggtgctgacgctcgaggtggccggt
gccgccgcgccggctccggcacctgccgcagcggctgcggtgcctgcaccggccccggct
gctccggcggccgcgccggtggcggcacccgctgcggctgcggccggcccgatcgagatc
ttcgtgcccgacatcggtgatttcgactcggtcgcggtgatcgagctgctggtcaagccg
ggtgacaccgtcaaggccgagcagagcctgatcacggtcgagagcgacaaggcctcgatg
gagatcccgtcgtcgcatgccggcgtgatcaaggaactcaaggtcaagctcggcgacaag
gtcagcaagggttcgctggtcgcgatcatcgaaggcgcggccggtgccgcaccggctgcg
gctgccccggcgcctgccgctgctgccgcgcctgcagccgcacctgtcgctgcggcggct
gccgtggtggcagcgcctgccgcggccagcgtgccggcccacgatcccaccgtgctgaac
ctgtcgctgccgcacgcatcgcccagcatccgcaagttcgcccgcgaactgggcgtgccg
ctggccgaggtcaagggctccggccccaagggccgcatcaccgaggtcgacgtgcaaggc
ttcgtcaagggcgtgatggccggcaccgcgcagaccgcggcgcagaaggccaaggcgccc
gcaccggctgcggccggtggtggcgaggccttcccgggcctgctggcctggcccaaggtc
gatttcgccaagttcggcccggtcgagcgcaaggacctctcgcgcatcaagaagatctcg
ggcgccaacctgcaccgcaactgggtgatcattccgcacgtcacgaaccatgacgacgcg
gacatcaccgatctcgaagccttccgcgttgccaccaacaaggaaaacgagaagtccggc
gtcaaggtcacgatgctggccttcatgatcaaggcggcggtcgcggcgctgaagaagttc
cccgagttcaacgcctcgctcgacggcgacacgctggtgctcaagaactacttccacatc
ggcttcgcggccgatacgcccaacggcctgatggtcccggtgatcaaggatgccgacaag
aagggcatcttccagatcagcaccgagatgggcgagctggccaagaaggcccgcgacggc
aagctcggccccgccgagatgagcggcggctgcttcagcatcagctcgctcggcggcatc
ggcgggcgctatttcacgcccatcatcaatgcgccggaagtggccatcatgggcgtgtgc
aagagcgccatcgagcccaagtgggacggcaaggccttccagccgcgcctgatgctgccg
ctgtcgctgtcgtgggatcaccgcgtcatcgacggcgcggctgcggcccgcttcaacgtc
tacttcgcatcgctgctggcggacttccgccgcatcgtgctctga

DBGET integrated database retrieval system