KEGG   Leptothrix cholodnii: Lcho_1647Help
Entry
Lcho_1647         CDS       T00681                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lch  Leptothrix cholodnii
Pathway
lch00010  Glycolysis / Gluconeogenesis
lch00020  Citrate cycle (TCA cycle)
lch00620  Pyruvate metabolism
lch01100  Metabolic pathways
lch01110  Biosynthesis of secondary metabolites
lch01120  Microbial metabolism in diverse environments
lch01130  Biosynthesis of antibiotics
lch01200  Carbon metabolism
Module
lch_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lcho_1647
   00020 Citrate cycle (TCA cycle)
    Lcho_1647
   00620 Pyruvate metabolism
    Lcho_1647
Enzymes [BR:lch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Lcho_1647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: ACB33914
JGI: Lcho1647
UniProt: B1XXD3
Position
1754941..1756605
Genome map
AA seq 554 aa AA seqDB search
MALIEVKVPDIGDFKDVAIIELLVKPGDTVKAEQSLLTVESDKASMEIPSSHAGVVKDLK
VALGDKINEGTVVLTLEVAGAAAPAPAPAAAAAVPAPAPAAPAAAPVAAPAAAAAGPIEI
FVPDIGDFDSVAVIELLVKPGDTVKAEQSLITVESDKASMEIPSSHAGVIKELKVKLGDK
VSKGSLVAIIEGAAGAAPAAAAPAPAAAAAPAAAPVAAAAAVVAAPAAASVPAHDPTVLN
LSLPHASPSIRKFARELGVPLAEVKGSGPKGRITEVDVQGFVKGVMAGTAQTAAQKAKAP
APAAAGGGEAFPGLLAWPKVDFAKFGPVERKDLSRIKKISGANLHRNWVIIPHVTNHDDA
DITDLEAFRVATNKENEKSGVKVTMLAFMIKAAVAALKKFPEFNASLDGDTLVLKNYFHI
GFAADTPNGLMVPVIKDADKKGIFQISTEMGELAKKARDGKLGPAEMSGGCFSISSLGGI
GGRYFTPIINAPEVAIMGVCKSAIEPKWDGKAFQPRLMLPLSLSWDHRVIDGAAAARFNV
YFASLLADFRRIVL
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcattgattgaagtgaaggtccccgacatcggggatttcaaggacgtcgcgatcatc
gaactgctggtcaagccgggtgacaccgtcaaggccgagcagagcctgctcaccgtcgag
agcgacaaggcctcgatggagatccccagctcgcacgccggcgtggtcaaggacctcaag
gtcgccctgggcgacaagatcaacgaaggcaccgtggtgctgacgctcgaggtggccggt
gccgccgcgccggctccggcacctgccgcagcggctgcggtgcctgcaccggccccggct
gctccggcggccgcgccggtggcggcacccgctgcggctgcggccggcccgatcgagatc
ttcgtgcccgacatcggtgatttcgactcggtcgcggtgatcgagctgctggtcaagccg
ggtgacaccgtcaaggccgagcagagcctgatcacggtcgagagcgacaaggcctcgatg
gagatcccgtcgtcgcatgccggcgtgatcaaggaactcaaggtcaagctcggcgacaag
gtcagcaagggttcgctggtcgcgatcatcgaaggcgcggccggtgccgcaccggctgcg
gctgccccggcgcctgccgctgctgccgcgcctgcagccgcacctgtcgctgcggcggct
gccgtggtggcagcgcctgccgcggccagcgtgccggcccacgatcccaccgtgctgaac
ctgtcgctgccgcacgcatcgcccagcatccgcaagttcgcccgcgaactgggcgtgccg
ctggccgaggtcaagggctccggccccaagggccgcatcaccgaggtcgacgtgcaaggc
ttcgtcaagggcgtgatggccggcaccgcgcagaccgcggcgcagaaggccaaggcgccc
gcaccggctgcggccggtggtggcgaggccttcccgggcctgctggcctggcccaaggtc
gatttcgccaagttcggcccggtcgagcgcaaggacctctcgcgcatcaagaagatctcg
ggcgccaacctgcaccgcaactgggtgatcattccgcacgtcacgaaccatgacgacgcg
gacatcaccgatctcgaagccttccgcgttgccaccaacaaggaaaacgagaagtccggc
gtcaaggtcacgatgctggccttcatgatcaaggcggcggtcgcggcgctgaagaagttc
cccgagttcaacgcctcgctcgacggcgacacgctggtgctcaagaactacttccacatc
ggcttcgcggccgatacgcccaacggcctgatggtcccggtgatcaaggatgccgacaag
aagggcatcttccagatcagcaccgagatgggcgagctggccaagaaggcccgcgacggc
aagctcggccccgccgagatgagcggcggctgcttcagcatcagctcgctcggcggcatc
ggcgggcgctatttcacgcccatcatcaatgcgccggaagtggccatcatgggcgtgtgc
aagagcgccatcgagcccaagtgggacggcaaggccttccagccgcgcctgatgctgccg
ctgtcgctgtcgtgggatcaccgcgtcatcgacggcgcggctgcggcccgcttcaacgtc
tacttcgcatcgctgctggcggacttccgccgcatcgtgctctga

DBGET integrated database retrieval system