KEGG   Leptothrix cholodnii: Lcho_1682Help
Entry
Lcho_1682         CDS       T00681                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lch  Leptothrix cholodnii
Pathway
lch00260  Glycine, serine and threonine metabolism
lch00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lch01100  Metabolic pathways
lch01110  Biosynthesis of secondary metabolites
lch01130  Biosynthesis of antibiotics
lch01230  Biosynthesis of amino acids
Module
lch_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lcho_1682
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Lcho_1682
Enzymes [BR:lch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Lcho_1682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP THUMP
Motif
Other DBs
NCBI-ProteinID: ACB33949
JGI: Lcho1682
UniProt: B1XY48
Position
1794428..1795714
Genome map
AA seq 428 aa AA seqDB search
MFDYQQPDARGHFGIYGGSFVAETLSHALDELNAAYERYRHDPEFIAEFRNELAHFVGRP
SPVYHAARMSREVGGAQIYLKREDLNHTGAHKINNTIGQALLARRMGKPRVIAETGAGQH
GVATATICARYGMECVVYMGSEDVKRQSPNVYRMNLLGARVVPVESGSKTLKDALNEAMR
DWVTNVENTFYIIGTVAGPHPYPAMVRDFQRVIGDECLVQMPALAGRQPDAVVACVGGGS
NAMGIFYPYIPHEGVRLIGVEAAGEGMESGKHSASLQRGSPGVLHGNRTYVLQDANGQIT
ETHSVSAGLDYPGVGPEHAYLKDIGRAEYVGITDAEALQAFHYLCRAEGIIPALESSHAV
AYAMKLAKTMRPDQHVLVNLSGRGDKDIGTVADLSGADFYCRPSCRGQSVKGGDPSVVEI
QRKAGGVQ
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgttcgattaccagcaacccgatgcccgcgggcatttcgggatctacggcggcagcttt
gtcgccgaaaccctgagccacgcgctcgacgaactgaatgcggcctacgagcgttaccgc
cacgaccccgagttcatcgccgaattccgcaacgaactggcgcatttcgtcggccgcccg
agcccggtctatcacgccgcacgcatgagccgtgaagtgggcggcgcgcagatctacctc
aagcgcgaggatctcaaccacaccggcgcgcacaagatcaacaacaccatcggccaggcg
ctgctcgcccggcgcatgggcaagccgcgcgtgatcgccgagaccggtgccggccagcat
ggcgtggccaccgccaccatctgcgcgcgctacggcatggaatgcgtggtctacatgggc
agcgaggacgtcaagcgccagagccccaacgtctaccgcatgaacctgctgggcgcgcgc
gtggtgccggtcgagtcgggcagcaagacgctcaaggatgcgctcaacgaggcgatgcgc
gactgggtcaccaacgtcgagaacaccttctacatcatcggcacggtggcggggccgcac
ccgtatccggcgatggtgcgcgacttccagcgcgtgatcggcgacgaatgcctggtgcag
atgcccgccctcgcgggccgtcaacccgatgcggtggtggcctgtgtcggtggcggcagc
aacgcgatgggcatcttctatccctacatcccgcatgaaggcgtgcgcctgatcggtgtc
gaggcggcgggcgagggcatggaaagcggcaagcattcggcctccttgcaacgcggctcc
cccggcgtgctgcacggcaaccgcacctatgtgctgcaggacgccaacggccagatcacc
gagacgcactcggtgtcggccggtctcgactaccccggcgtcggccccgagcacgcctac
ctgaaggacatcggccgtgccgaatacgtcggcatcaccgatgccgaggcgctgcaggcc
ttccattacctgtgccgcgccgagggcatcatcccggcactcgaatccagccacgcggtt
gcctacgcgatgaaactggccaagaccatgcgcccggaccagcacgtcctcgtcaatctg
tcgggccgtggcgacaaggacatcggcacggtggccgacctgtcgggcgccgatttctac
tgccggccgtcgtgccgcggccagagcgtgaagggcggcgatccgtccgtggtcgagatc
cagcgcaaggccgggggtgtgcaatga

DBGET integrated database retrieval system