KEGG   Leptothrix cholodnii: Lcho_1683Help
Entry
Lcho_1683         CDS       T00681                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lch  Leptothrix cholodnii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Lcho_1683
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Lcho_1683
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Lcho_1683
Enzymes [BR:lch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Lcho_1683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1795711..1796526
Genome map
AA seq 271 aa AA seqDB search
MSRIAATFARLAGQGRKALIPYVTAGDPFADITVDLMHAMAKAGADVIELGVPFSDPMAD
GPVIQRASERALSRNISTADVLAMVARFRETDDTTPVVLMGYANPVERYGPDRFVDDARA
AGVDGVLVVDYPPQECEAFADRLRAADLDPIFLLAPTSTDARMADVGRIATGYVYYVSLK
GVTGSGNLDTDAVARMIPRIRSHVSVPVGVGFGIRDAATAVAVARVSDAVVIGSRIIQLI
ENEPRERVVPVAAGFIAEIRTALDTLQGTHA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcatcgccgccaccttcgcgcgcctggccgggcagggccgcaaggcgctgatt
ccgtatgtgactgccggcgatccgtttgccgacatcacggtcgatctgatgcacgccatg
gccaaggcgggtgccgacgtgatcgaactgggcgtgccgttttcggatccgatggccgat
ggcccggtgatccagcgcgccagtgaacgcgcactctcgcgcaacatctccaccgccgac
gtgctggcgatggtggcgcggttccgcgaaaccgacgacaccacgccggtggtgctgatg
ggctacgccaacccggtcgagcgttacggcccggatcggttcgtcgacgatgcgcgtgcg
gccggtgtcgacggcgtgctggtggtcgactacccgccgcaggagtgcgaggcgttcgcc
gatcgcctgcgtgcggccgatctcgacccgatcttcctgctggcgccgacctcgaccgat
gcccgcatggccgacgtcggccgcatcgccaccggctacgtgtactacgtgtcgctcaag
ggcgtgaccggctcgggcaacctcgacaccgacgcggtggcccgcatgatcccgcgcatc
cgcagccatgtgagcgtgccggtcggcgtgggattcggcatccgcgacgcggcgacggcc
gtggcggtggcccgggtatcggacgccgtggtgatcggttcccgtatcattcaactgatc
gaaaacgagccgcgtgagcgggtggtaccggtggctgccggtttcatcgccgaaattcgc
acggccctcgacaccctgcaaggaacacacgcatga

DBGET integrated database retrieval system