KEGG   Leptothrix cholodnii: Lcho_1744Help
Entry
Lcho_1744         CDS       T00681                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
lch  Leptothrix cholodnii
Pathway
lch00630  Glyoxylate and dicarboxylate metabolism
lch01100  Metabolic pathways
lch01110  Biosynthesis of secondary metabolites
lch01120  Microbial metabolism in diverse environments
lch01200  Carbon metabolism
Module
lch_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Lcho_1744
Enzymes [BR:lch01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Lcho_1744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACB34011
JGI: Lcho1744
UniProt: B1XYZ2
Position
1863526..1864842
Genome map
AA seq 438 aa AA seqDB search
MSSLTREQQIAALEKDWAENPRWKLVKRGYSAADVVRLRGSMQPEYTLAKMGAEKLWDKV
NGGAKKGYVNAFGAITAGQAMQQAKAGLEAVYLSGWQVAADGNTSETMYPDQSLYAYDSV
PTMVRRINNTFKRADEIQWGRGINPGDEGFVDYFLPIVADAEAGFGGVLNAFELMKNMIA
SGAAGVHFEDQLAAVKKCGHMGGKVLVPTREAVEKLIAARFAADVMGVPTIVLARTDAEA
ANLLTSDCDANDQPFVTGERTQEGFYRVKNGLEQAISRGIAYAPYADLVWCETGVPDIGF
AREFAQAVHGACPGKLLSYNCSPSFNWKKNLNDSQIAAFQEELSALGYKYQFITLAGIHI
NWYNTFQFAHSYARGEGMKHYVEMVQEQEFAARDKGYTFVSHQQEVGAGYFDDVTTVIQG
GSSSVKALTGSTEEEQFH
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcctgacccgcgaacaacagatcgccgccctggaaaaagactgggccgagaac
ccccgctggaagctggtgaagcgcggctacagcgccgctgacgtcgtgcgcctgcgcggc
agcatgcagcccgagtacacgctggccaagatgggcgccgaaaagctgtgggacaaggtc
aacggcggcgccaagaagggctacgtgaacgcgttcggcgcgatcaccgccggtcaggcg
atgcaacaggccaaggccggcctggaagccgtgtacctgtcgggctggcaggtcgccgcc
gacggcaacacctccgaaaccatgtaccccgaccagtcgctgtatgcgtacgactcggtg
ccgaccatggtgcgccgcatcaacaacaccttcaagcgcgctgacgagatccagtggggc
cgtggcatcaacccgggcgatgaaggtttcgtcgactacttcctgccgatcgtcgctgac
gcggaagccggtttcggcggcgtgctgaacgccttcgaactgatgaagaacatgatcgcg
tcgggcgctgccggcgtccacttcgaagaccagctcgccgcggtcaagaagtgcggtcac
atgggtggcaaggtgctggttccgacccgcgaagccgtcgagaagctgatcgccgcccgg
ttcgccgctgacgtcatgggcgtgccgaccatcgtgctggcccgtaccgacgccgaagcg
gccaacctgctgaccagtgattgcgacgccaacgaccagccgttcgtcaccggcgagcgt
acgcaagagggcttctaccgcgtcaagaacggcctggagcaggccatcagccgcggcatc
gcctacgcgccgtacgccgacctggtgtggtgcgaaaccggcgtgcccgacatcggcttc
gcccgtgaattcgcgcaagccgtgcacggtgcatgcccgggcaagctgctgagctacaac
tgctcgccgtcgttcaactggaagaagaacctgaacgacagccagatcgccgccttccag
gaagagctgagcgcgctgggctacaagtaccagttcatcacgctggccggcatccacatc
aactggtacaacaccttccagttcgcccactcctacgcccgcggcgaaggcatgaagcac
tacgtggaaatggtccaggagcaggaattcgctgcgcgcgacaagggttacaccttcgtg
tcgcaccagcaggaagtcggcgctggctacttcgacgacgtcaccaccgtgatccagggc
ggctcgtccagcgtcaaggcgctgaccggctcgaccgaagaagaacagttccactga

DBGET integrated database retrieval system