KEGG   Leptothrix cholodnii: Lcho_1778Help
Entry
Lcho_1778         CDS       T00681                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lch  Leptothrix cholodnii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lch00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Lcho_1778
Enzymes [BR:lch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Lcho_1778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1919848..1922067
Genome map
AA seq 739 aa AA seqDB search
MSPHVPDGQVDLFGPVSGQLPGHPTGEPAEPGDAPSPSAVLAELAAWAEAGWLRALDLSL
ARLLVQQCPDASAHLALAAALLAHNEGRGHTCLPLDEWLASVDEAAAPTAPGGSHARPLT
EPWLDGPADAQAALARQLRALGTDPGEWRAALLCSGAVAAAGEIVATGLASPLILSGSRL
YLRRHFRDEQAVAQAVVGRAAAAMPVAEGAPQAQPHAGTEPPDAAQVRLWLDRLFGGPPA
PDRFDWQRSACAIALRGRLALITGGPGTGKTYTVARLLALVMAVHPQPQALRIALAAPTG
KAAARLKQSIDSALQQLAAALPGALDWGLLQQRLSQSLTLHKLLGARPDTRRFGRDARHP
LEVDLLVVDEASMVHLEMMAALLAALPPASRLVLLGDKDQLASVEAGAVLGDLCVDAAAG
GYDEDTAAWIQACVGQALPQPFRCGQPGPLAQQTVMLRESRRFEGPIGALALAVNAGDVT
AARRLLGLGVPAPADDGSLRAPTGVTPAAVCDLAVHGRAGNDASATGFVNYLRLLREGAP
RRADGPSPDGVRAVLQAFERCRVLCAVREGEWGVAGLNAAIERQLRQQGWIARQGEWYEG
RPVMVTRNDPALGVFNGDIGLALRGPAQPGGAQGAGGPLRVWFLDGEQPRSVLASRLAAV
ETAYAMTVHKSQGSEFEHTVLVLPPHANPVLTRELVYTGITRARRAFTLVAPEPAVFDLA
LQRRTRRASGLPDLLAAGA
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgagccctcatgtgcccgatggtcaggtcgatctgttcggcccggtgtccggccaattg
cctggccatccgacgggcgagccggccgagccgggggatgccccgtcaccgtccgccgtg
ctggccgaactcgctgcctgggccgaagccggctggctgcgcgcgctcgacctgtcgctg
gcgcgcctgctggtgcagcaatgcccggatgcctcggcgcatctggcgctggccgccgcg
ctgctggcgcacaacgagggccgcggccacacctgcctgccgctggacgaatggctggcg
tcggtcgacgaggccgccgcgcccaccgcccccggcgggtcgcacgcccggcccctcacc
gagccgtggctggatggcccggccgatgcgcaggccgcactcgcccgacagctgcgtgcg
ctcggcaccgatcccggcgagtggcgcgccgccttgctgtgcagcggcgcggtggccgcc
gcgggcgagatcgtggcgaccggcctggcgagcccgctgatcctgtccggcagccggctc
tacctgcgccgccatttccgcgacgagcaggccgtggcgcaggcggtggtcgggcgcgcc
gccgccgcgatgccggtggccgaaggggcgccgcaggcgcagccgcatgcgggcaccgag
ccaccggacgccgcgcaggtgcgcctgtggctcgaccgcctgttcggcggtccgcccgcg
ccggatcgtttcgactggcagcgcagcgcctgcgcgatcgcgttgcgcggccggctggcg
ctgatcaccggcgggccgggcaccggcaagacctacaccgtggcgcggctgctggcgctg
gtgatggcggtgcatccgcagccgcaggcgctgcgcatcgcgctggcggcgcccaccggc
aaggcggcggcgcggctcaagcagtcgatcgacagcgcgctgcagcagctggccgcggcg
ctgccgggggcgctcgactggggtctgctgcagcagcgcctgtcgcagtcgctgacgctg
cacaagctgctgggtgcgcggccggacacccgccgtttcggccgcgatgcgcgccatccg
ctcgaggtcgacctgctggtggtggacgaggcgtcgatggtccacctcgagatgatggcc
gcgctgctggccgcgctgccgccggcgtcacggctggtgctgctgggcgacaaggaccag
ctggcgtcggtcgaggccggtgcggtgctgggcgacctgtgtgtcgacgccgccgcgggc
ggttacgacgaggacaccgccgcctggatccaggcctgtgtcggccaggcgctgccgcag
ccgttccgctgcggccagccgggcccgctggcgcagcagaccgtgatgctgcgcgagagc
cggcgcttcgagggcccgatcggcgcactcgcgctggcggtcaatgccggtgatgtgacc
gcagcgcgccggctgctcgggctgggcgtgccggcgccggccgacgacggcagcctgcgc
gcgccgacgggtgtcacgcccgctgcggtctgtgatctggccgtgcacggacgcgccggc
aacgacgcttcggcgaccggcttcgtcaactatctgcgcctgctgcgcgagggcgcgccc
aggcgcgccgacgggccgagtccggacggcgtgcgagcggttctgcaggccttcgagcgt
tgccgggtgctgtgcgcggtgcgcgagggcgagtggggcgtcgccgggctgaacgcggcg
atcgagcgccagctgcgccagcagggctggatcgcgcgccagggcgagtggtacgagggc
cggccggtgatggtgacgcgcaacgatccggcgctcggtgtcttcaacggcgacatcggc
ctggcgctgcgcgggccggcgcagccggggggggcccagggggcgggcggcccgttgcgg
gtctggtttctcgatggcgagcagccgcgctcggtgctggccagccggctcgccgcggtc
gagacggcgtacgcgatgacggtgcacaagtcgcagggctcggagttcgagcacacggtg
ctggtgctgccgccgcacgccaacccggtgctgacgcgcgagctggtctacaccggcatc
acgcgggcgcggcgggcgttcacgctggtcgcgcccgagccggcggtgttcgacctggcg
ttgcagcggcgcacccggcgcgccagcggcctgcccgatctgctggcggccggcgcctga

DBGET integrated database retrieval system