KEGG   Leptothrix cholodnii: Lcho_1778Help
Entry
Lcho_1778         CDS       T00681                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lch  Leptothrix cholodnii
Pathway
lch03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lch00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Lcho_1778
Enzymes [BR:lch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Lcho_1778
DNA repair and recombination proteins [BR:lch03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Lcho_1778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 Helicase_RecD AAA_11 AAA_25 AAA_22 UvrD-helicase PhoH DUF2075 AAA_16 AAA_28 Mg_chelatase UvrD_C ATPase
Motif
Other DBs
NCBI-ProteinID: ACB34045
JGI: Lcho1778
UniProt: B1XZ26
Position
1919848..1922067
Genome map
AA seq 739 aa AA seqDB search
MSPHVPDGQVDLFGPVSGQLPGHPTGEPAEPGDAPSPSAVLAELAAWAEAGWLRALDLSL
ARLLVQQCPDASAHLALAAALLAHNEGRGHTCLPLDEWLASVDEAAAPTAPGGSHARPLT
EPWLDGPADAQAALARQLRALGTDPGEWRAALLCSGAVAAAGEIVATGLASPLILSGSRL
YLRRHFRDEQAVAQAVVGRAAAAMPVAEGAPQAQPHAGTEPPDAAQVRLWLDRLFGGPPA
PDRFDWQRSACAIALRGRLALITGGPGTGKTYTVARLLALVMAVHPQPQALRIALAAPTG
KAAARLKQSIDSALQQLAAALPGALDWGLLQQRLSQSLTLHKLLGARPDTRRFGRDARHP
LEVDLLVVDEASMVHLEMMAALLAALPPASRLVLLGDKDQLASVEAGAVLGDLCVDAAAG
GYDEDTAAWIQACVGQALPQPFRCGQPGPLAQQTVMLRESRRFEGPIGALALAVNAGDVT
AARRLLGLGVPAPADDGSLRAPTGVTPAAVCDLAVHGRAGNDASATGFVNYLRLLREGAP
RRADGPSPDGVRAVLQAFERCRVLCAVREGEWGVAGLNAAIERQLRQQGWIARQGEWYEG
RPVMVTRNDPALGVFNGDIGLALRGPAQPGGAQGAGGPLRVWFLDGEQPRSVLASRLAAV
ETAYAMTVHKSQGSEFEHTVLVLPPHANPVLTRELVYTGITRARRAFTLVAPEPAVFDLA
LQRRTRRASGLPDLLAAGA
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgagccctcatgtgcccgatggtcaggtcgatctgttcggcccggtgtccggccaattg
cctggccatccgacgggcgagccggccgagccgggggatgccccgtcaccgtccgccgtg
ctggccgaactcgctgcctgggccgaagccggctggctgcgcgcgctcgacctgtcgctg
gcgcgcctgctggtgcagcaatgcccggatgcctcggcgcatctggcgctggccgccgcg
ctgctggcgcacaacgagggccgcggccacacctgcctgccgctggacgaatggctggcg
tcggtcgacgaggccgccgcgcccaccgcccccggcgggtcgcacgcccggcccctcacc
gagccgtggctggatggcccggccgatgcgcaggccgcactcgcccgacagctgcgtgcg
ctcggcaccgatcccggcgagtggcgcgccgccttgctgtgcagcggcgcggtggccgcc
gcgggcgagatcgtggcgaccggcctggcgagcccgctgatcctgtccggcagccggctc
tacctgcgccgccatttccgcgacgagcaggccgtggcgcaggcggtggtcgggcgcgcc
gccgccgcgatgccggtggccgaaggggcgccgcaggcgcagccgcatgcgggcaccgag
ccaccggacgccgcgcaggtgcgcctgtggctcgaccgcctgttcggcggtccgcccgcg
ccggatcgtttcgactggcagcgcagcgcctgcgcgatcgcgttgcgcggccggctggcg
ctgatcaccggcgggccgggcaccggcaagacctacaccgtggcgcggctgctggcgctg
gtgatggcggtgcatccgcagccgcaggcgctgcgcatcgcgctggcggcgcccaccggc
aaggcggcggcgcggctcaagcagtcgatcgacagcgcgctgcagcagctggccgcggcg
ctgccgggggcgctcgactggggtctgctgcagcagcgcctgtcgcagtcgctgacgctg
cacaagctgctgggtgcgcggccggacacccgccgtttcggccgcgatgcgcgccatccg
ctcgaggtcgacctgctggtggtggacgaggcgtcgatggtccacctcgagatgatggcc
gcgctgctggccgcgctgccgccggcgtcacggctggtgctgctgggcgacaaggaccag
ctggcgtcggtcgaggccggtgcggtgctgggcgacctgtgtgtcgacgccgccgcgggc
ggttacgacgaggacaccgccgcctggatccaggcctgtgtcggccaggcgctgccgcag
ccgttccgctgcggccagccgggcccgctggcgcagcagaccgtgatgctgcgcgagagc
cggcgcttcgagggcccgatcggcgcactcgcgctggcggtcaatgccggtgatgtgacc
gcagcgcgccggctgctcgggctgggcgtgccggcgccggccgacgacggcagcctgcgc
gcgccgacgggtgtcacgcccgctgcggtctgtgatctggccgtgcacggacgcgccggc
aacgacgcttcggcgaccggcttcgtcaactatctgcgcctgctgcgcgagggcgcgccc
aggcgcgccgacgggccgagtccggacggcgtgcgagcggttctgcaggccttcgagcgt
tgccgggtgctgtgcgcggtgcgcgagggcgagtggggcgtcgccgggctgaacgcggcg
atcgagcgccagctgcgccagcagggctggatcgcgcgccagggcgagtggtacgagggc
cggccggtgatggtgacgcgcaacgatccggcgctcggtgtcttcaacggcgacatcggc
ctggcgctgcgcgggccggcgcagccggggggggcccagggggcgggcggcccgttgcgg
gtctggtttctcgatggcgagcagccgcgctcggtgctggccagccggctcgccgcggtc
gagacggcgtacgcgatgacggtgcacaagtcgcagggctcggagttcgagcacacggtg
ctggtgctgccgccgcacgccaacccggtgctgacgcgcgagctggtctacaccggcatc
acgcgggcgcggcgggcgttcacgctggtcgcgcccgagccggcggtgttcgacctggcg
ttgcagcggcgcacccggcgcgccagcggcctgcccgatctgctggcggccggcgcctga

DBGET integrated database retrieval system