KEGG   Leptothrix cholodnii: Lcho_1830Help
Entry
Lcho_1830         CDS       T00681                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
lch  Leptothrix cholodnii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Lcho_1830
Enzymes [BR:lch01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Lcho_1830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1978722..1979474)
Genome map
AA seq 250 aa AA seqDB search
MTTHHSLPILAAERGLAVQETDDSGVPVSVRIRERIKAARQRFHANDNIAEFIRPGELEA
LLDEVSGKMSAVLSSLVIDTESDHNTQDTARRVAKMYLKEVFRGRYVEQPPVTEFPNVER
LNELMIVGPVTVRSACSHHLCPIVGKLWIGVMPNEHSNLIGLSKYARLAEWIMSRPQIQE
EAVTQVADLLQDKMQPDGLAVVMEADHFCMSWRGVKDMDSKMINSVMRGSFLKDPNLRRE
FLSLLQHKKT
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcatcattcgctccccatcctggccgctgaacgcggtctcgccgtacaagag
acggacgactccggcgtgccggtgtcggtgcgcatccgcgaacggatcaaggccgcccgg
caacgtttccacgccaacgacaacatcgccgagttcatccgcccgggtgaactcgaggcc
ctgctcgacgaggtctcgggcaagatgtcggcggtgctgtcgagcctggtgatcgacacc
gagagcgatcacaacacccaggacaccgcccgccgcgtcgccaagatgtacttgaaggag
gtcttccgcggccgctacgtcgaacagccgccggtgaccgagttccccaacgtcgagcgc
ctcaacgagctgatgatcgtcggcccggtgaccgtgcgcagcgcctgctcgcaccacctg
tgcccgatcgtcggcaagctgtggatcggcgtgatgcccaacgagcactccaacctgatc
ggcctgtcgaagtacgcccggctggccgagtggatcatgagccgcccgcagatccaggaa
gaagccgtcacccaggtggccgacctgctgcaggacaagatgcagcccgacggcctggcg
gtggtgatggaggccgaccacttctgcatgagctggcgcggcgtcaaggacatggactcg
aagatgatcaacagcgtgatgcgcggctccttcctgaaggaccccaacctgcgccgcgaa
ttcctgtcgctgctgcaacacaagaagacctga

DBGET integrated database retrieval system