KEGG   Leptothrix cholodnii: Lcho_1859Help
Entry
Lcho_1859         CDS       T00681                                 

Definition
di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
lch  Leptothrix cholodnii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2009930..2011126)
Genome map
AA seq 398 aa AA seqDB search
MSRGSVKSRVRLAGLALLGAALAACGGGGTQVTETGLSNSEGWTFAVPADFPAPRDSADN
PTTAARVELGRFLFYERRLSGNGTQSCGSCHLQDKAFTDGLTTAVGSTGESHPRNSQSLV
NVIYNATLTWANPTLVTLETQMLTPLFGTRPVEMGVNDANKFEVLARISGSSAPDYGRLF
AAAFPGQPGALNWDNVIRAIASFQRSMISADSRYDRARQNRATLSDAEQRGQTLFFGEQA
ECFHCHGSFNFNEQVIYNGLRQVETPFRNTGLYNIGGSGAFPFPNQGLFSFTEAAPDMGK
FRAPSLRNIAVTAPYMHDGTMATLEEVLDFYAAGGRVIADGPLAGDGRANPFKDGLIARI
NLSAQDKADLIAFLRTLTDERLLGDPALSDPFVSTPAR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgaggcagcgtgaaatcccgggtccggctcgccggcctggccctgctcggggcc
gccctggcggcctgcggtggcgggggtacccaggtcaccgagaccgggctgagcaattcc
gagggctggaccttcgccgttccggccgacttcccggcgccacgcgactcggccgacaac
ccgaccacggcggcccgggtcgagctcggccgcttcctgttctacgaacggcgcctgtcg
ggcaacggcacgcagtcctgcggcagctgccacctgcaggacaaggccttcaccgacggg
ctcaccaccgccgtgggttccaccggcgagagccacccgcgcaattcgcagagcctggtc
aacgtcatctacaacgcgacgctgacctgggccaacccgacgctggtgacgctggaaacc
cagatgctcacgccgctcttcggcacccggccggtggagatgggcgtcaacgacgccaac
aagttcgaggtgctggcccgcatctcgggcagcagcgcgcccgactacggccggctgttc
gccgcggcctttccgggccagcccggtgcgctgaactgggacaacgtgatccgcgcgatc
gccagcttccagcgcagcatgatctcggccgacagccgctacgaccgggcccggcagaac
cgggccacgctgagcgacgccgaacaacgcggccagacgctcttcttcggcgaacaggcc
gaatgtttccactgccacggcagcttcaacttcaacgagcaggtgatctacaacggcctg
cgccaggtcgagacgccgttccgcaacaccgggctctacaacatcggcggcagcggcgcc
tttccgttccccaaccaaggtctgttctccttcaccgaggcggcgcccgacatgggcaag
ttccgcgcgccgagcctgcgcaacatcgccgtcacggcgccctacatgcacgacggcacg
atggccacgctggaggaggtgctcgacttctacgccgccggcgggcgcgtgatcgccgac
ggcccgctggccggcgacggccgtgccaatccgttcaaggacggcctgatcgcccgcatc
aacctgagcgcccaggacaaggccgacctgatcgccttcctgcgcacgctgaccgacgaa
cggctgctgggcgatccggcgctgtccgatcccttcgtgagcacgcccgcgcgctga

DBGET integrated database retrieval system