KEGG   Leptothrix cholodnii: Lcho_1901Help
Entry
Lcho_1901         CDS       T00681                                 

Definition
GDSL family lipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
lch  Leptothrix cholodnii
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Lcho_1901
Enzymes [BR:lch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Lcho_1901
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Lcho_1901
Lipid biosynthesis proteins [BR:lch01004]
 Fatty acid synthase
  Component type
   Lcho_1901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2058549..2059193)
Genome map
AA seq 214 aa AA seqDB search
MIGLRAAGAGAIAALASSGTALAAAAQQRKILVVGDSLSAEYGLPRGSGWVALLEARLAA
HKPAYTVINASISGDTTSGGRSRLPALLVQHKPSHVVIELGGNDALRGLPLAMTEANLLA
MAQAARAAGAAVMLVGMQVPPNYGQAYSRDFAGLFGKVAQRERAALVPFLLAGIADASDA
QKWFQPDRIHPTAQAHPRMLENVWQVMTGWLGRG
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgggctgcgcgccgccggcgcaggggcgatcgccgcactggcgtcttcaggcacg
gcactcgcggcggcagcgcagcaacgcaagatcctggtggtcggcgacagcctgtcggcc
gaatacggcctgccccgcggcagcggctgggtcgcgttgctcgaggcccgactggcggcg
cacaagccggcctacaccgtgatcaacgccagcatcagtggcgacaccacctcgggtggc
cgctcgcgcctgccggcgctgctcgtccagcacaagcccagtcacgtggtgatcgagctc
ggcggcaacgacgccctgcgcggcctgccgctggccatgaccgaagccaacctgctggcg
atggcgcaggcggcccgcgctgctggcgcagcagtcatgctcgtgggcatgcaggtgccg
cccaactacgggcaggcctacagccgcgatttcgccggactgttcggcaaggtggcccag
cgcgaacgtgccgcgctggtgccgttcctgctcgccggcattgccgacgcgtccgacgcc
cagaagtggttccagccggaccgcatccaccccaccgcccaagcgcatccgcgcatgctc
gaaaacgtctggcaggtgatgacgggctggctcgggcggggctga

DBGET integrated database retrieval system