KEGG   Leptothrix cholodnii: Lcho_1921Help
Entry
Lcho_1921         CDS       T00681                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
lch  Leptothrix cholodnii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2083125..2083976)
Genome map
AA seq 283 aa AA seqDB search
MSESQPPRRGRFPLPLSATTPVVRRFVSTGQAVLQPVPPRPQRPASEITRETARPAILAG
HGLDSDGFRARMIERLRADGCRDEHVLRAMSRVPRHLFVDSALAAQAYEDTSLPIGHGQT
ISKPSVVARMLGLLRQRPGGAQLGRVLEIGTGCGYQAAVLCRLASQVYSIERLKALHDRA
RENLAPMRRDQLRLIYGDGLHGHGPNAPFDAIIAAAGGHAIPQAWLDQLAVCGRLVAPMH
DAQRGTQVLVVVDRMPDGSLVQHRHETVRFVPLESGTSDYKPA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagtcgcagccgccgcggcgcggacgcttcccgctgccgctgtcggcgacgacg
ccggtggtgcgccgatttgtctcgacggggcaggccgtgttgcaaccggtcccgccacga
ccgcagcggccggcatccgaaatcacccgcgagacggcccgaccggccatcctggccgga
cacggcctcgattcggacggcttccgggcccgcatgatcgagcgactgcgcgccgacggc
tgccgcgacgaacacgtcctgcgcgcgatgagccgcgtgccgcgccacctgttcgtcgac
tcggcactggcggcgcaggcctacgaggacaccagcctgccgatcggccacggccagacg
atctcgaaaccctcggtggtggcgcgcatgctcggcctgctgcgccaacgccccggcggc
gcgcagctcgggcgcgtgctcgagatcggcaccggctgcggctaccaggccgcggtgctg
tgccggctggcatcgcaggtctactcgatcgagcgcctcaaggcgctgcacgaccgggcg
cgcgaaaacctcgcgccgatgcgacgcgatcagctgcggctgatctacggcgacggcctg
catggccacggccccaacgcgcccttcgacgccatcatcgcggccgccggcggacatgcc
atcccgcaggcctggctcgaccagctggccgtctgcggccgcctggtggcgcccatgcac
gacgcgcagcgcggcacccaggtgctcgtcgtggtggatcgcatgcccgacggctcgctg
gtgcagcatcgacatgaaaccgtccgtttcgtccctttagaatccggcaccagcgattac
aagccggcttga

DBGET integrated database retrieval system