KEGG   Leptothrix cholodnii: Lcho_1921Help
Entry
Lcho_1921         CDS       T00681                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
lch  Leptothrix cholodnii
Brite
Enzymes [BR:lch01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Lcho_1921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_11 RrnaAD Methyltransf_23 Methyltransf_18
Motif
Other DBs
NCBI-ProteinID: ACB34188
JGI: Lcho1921
UniProt: B1Y0T0
Position
complement(2083125..2083976)
Genome map
AA seq 283 aa AA seqDB search
MSESQPPRRGRFPLPLSATTPVVRRFVSTGQAVLQPVPPRPQRPASEITRETARPAILAG
HGLDSDGFRARMIERLRADGCRDEHVLRAMSRVPRHLFVDSALAAQAYEDTSLPIGHGQT
ISKPSVVARMLGLLRQRPGGAQLGRVLEIGTGCGYQAAVLCRLASQVYSIERLKALHDRA
RENLAPMRRDQLRLIYGDGLHGHGPNAPFDAIIAAAGGHAIPQAWLDQLAVCGRLVAPMH
DAQRGTQVLVVVDRMPDGSLVQHRHETVRFVPLESGTSDYKPA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagtcgcagccgccgcggcgcggacgcttcccgctgccgctgtcggcgacgacg
ccggtggtgcgccgatttgtctcgacggggcaggccgtgttgcaaccggtcccgccacga
ccgcagcggccggcatccgaaatcacccgcgagacggcccgaccggccatcctggccgga
cacggcctcgattcggacggcttccgggcccgcatgatcgagcgactgcgcgccgacggc
tgccgcgacgaacacgtcctgcgcgcgatgagccgcgtgccgcgccacctgttcgtcgac
tcggcactggcggcgcaggcctacgaggacaccagcctgccgatcggccacggccagacg
atctcgaaaccctcggtggtggcgcgcatgctcggcctgctgcgccaacgccccggcggc
gcgcagctcgggcgcgtgctcgagatcggcaccggctgcggctaccaggccgcggtgctg
tgccggctggcatcgcaggtctactcgatcgagcgcctcaaggcgctgcacgaccgggcg
cgcgaaaacctcgcgccgatgcgacgcgatcagctgcggctgatctacggcgacggcctg
catggccacggccccaacgcgcccttcgacgccatcatcgcggccgccggcggacatgcc
atcccgcaggcctggctcgaccagctggccgtctgcggccgcctggtggcgcccatgcac
gacgcgcagcgcggcacccaggtgctcgtcgtggtggatcgcatgcccgacggctcgctg
gtgcagcatcgacatgaaaccgtccgtttcgtccctttagaatccggcaccagcgattac
aagccggcttga

DBGET integrated database retrieval system