KEGG   Leptothrix cholodnii: Lcho_2071Help
Entry
Lcho_2071         CDS       T00681                                 

Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
lch  Leptothrix cholodnii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Lcho_2071
Enzymes [BR:lch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Lcho_2071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2253814..2254953
Genome map
AA seq 379 aa AA seqDB search
MATRAQSANPCSAVEGPTGWPAWQTLRRTLMSRDGRVIDRYASDATTSEGQAYGLFFALV
DNDRAAFELLLRWTEDNLAAGDLAARLPAWRWGRRADGSWNVIDANSAADADLWLSYVLS
EAGRLWKNRRYDALGRVLARRIAAEEVIELPGLGTTLLPGPQGFRRGERGAKLNPSYLPP
QLLRWFARNRTESVWVPLRDASLRLLHDSAPHGLAPDWTVFDADRGWSLAELADDERSGS
YNAIRVYLWLGLTDPGDPARGRLLARYAPMARLSELLGGVPEKVDPARPALEQSAGAQAN
GPVGFQAAMLPFADALGQTALSERLADRVATQGVQPDAYYDQVLSLFALGFRERRYRFAA
DGSLQPGWASCDAPPGSSR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggccacgcgggcgcagtctgccaacccctgcagcgccgtcgagggcccgaccggctgg
ccggcatggcagaccctgcgccggaccctgatgagccgcgacggccgtgtcatcgaccgc
tacgcgagcgacgccaccacctccgaaggccaggcctacggcctgttcttcgcgctggtg
gacaacgaccgcgcggccttcgagctgctgttgcgctggaccgaagacaacctggcggcc
ggcgacctggccgcgcgcctgccggcctggcgctggggccggcgcgcggacggcagctgg
aacgtgatcgacgccaactccgccgccgacgccgacctgtggctgtcctacgtgctgtcc
gaggccggccggctctggaagaaccgccgctacgacgcgctcgggcgggtgctggcgcgc
cgcatcgccgccgaagaggtgatcgagctgcccggcctcggcaccaccctgctgcccggg
ccgcagggatttcgccgcggcgaacgcggcgccaagctcaacccgagctacctgccgccg
cagctgctgcgctggttcgcgcgcaaccgcaccgagtccgtctgggtgcccctgcgcgac
gcctcgctgcgcctgctgcacgacagcgcgccccacggcctggcgcccgactggaccgtg
ttcgacgccgaccggggctggagcctggccgaactggccgacgacgagcgcagcggcagc
tacaacgcgatccgggtctacctctggctcggcctgaccgatccgggcgatccggcgcgc
gggcgcctgctcgcccgctatgcgccgatggcgcggctgtccgaactgctcggcggcgtg
cccgagaaggtcgatccggcgcgccccgcactcgagcagtcggccggcgcgcaagccaac
gggccggtcggtttccaggccgccatgctgccgttcgccgacgcgctcggccagaccgcg
ctgagcgagcgtctggccgaccgcgtggccacgcagggcgtgcagccggacgcctattac
gaccaggtgctgagcctgttcgcgctcggcttccgcgagcggcgctaccgcttcgccgcc
gacggatcgctgcaaccgggatgggcctcatgcgacgcaccgcctggatcctcgcgctga

DBGET integrated database retrieval system