KEGG   Leptothrix cholodnii: Lcho_2149Help
Entry
Lcho_2149         CDS       T00681                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
lch  Leptothrix cholodnii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lcho_2149
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lcho_2149
   00020 Citrate cycle (TCA cycle)
    Lcho_2149
   00620 Pyruvate metabolism
    Lcho_2149
   00640 Propanoate metabolism
    Lcho_2149
   00650 Butanoate metabolism
    Lcho_2149
  Energy metabolism
   00680 Methane metabolism
    Lcho_2149
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Lcho_2149
Enzymes [BR:lch01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Lcho_2149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2350189..2350779
Genome map
AA seq 196 aa AA seqDB search
MLQIRIHGRGGQGVVTAAELLSVAAFEQDRHAQAFPSFGSERTGAPVVAFCRIDDREIRL
REPILAPDVLIVQDPTLLHQVDVFQGLQADGYVLINSRRSFDELGLGEIATRFRHERLIT
VPASEIAQKHLGRPLPNAVLLGGFAALSGLITLDAVAHAIGDKFSGKVAAANVAAASEAF
DYVRHQLRELTHAQAD
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagatccgcatccacgggcggggtgggcaaggcgtggtgacggcggccgagttg
ctgtcggtggccgccttcgagcaggaccgccacgcgcaggcctttccgagcttcggctcc
gaacgcaccggcgcgccggtggtggcgttctgccgcatcgacgaccgcgagatccgcctg
cgcgagcccatcctcgcgcccgacgtgctgatcgtgcaggacccgacgctgctgcaccag
gtcgacgtcttccagggcctgcaggccgacggctacgtgctgatcaacagccggcgcagc
ttcgacgaactcggcctgggcgagatcgccacgcgctttcgccatgaacgcctgatcacc
gtgccggccagcgagatcgcgcaaaagcacctcggccgcccgctgcccaacgccgtgctg
ctgggcggtttcgcggcgttgtcggggctgatcacgctcgacgccgtggcccatgcgatc
ggcgacaagttcagcggcaaggtggccgccgccaacgtggctgccgcgtccgaggccttc
gactacgtgcgccatcaactccgggaactgacccatgctcaagcagattga

DBGET integrated database retrieval system