KEGG   Leptothrix cholodnii: Lcho_2150Help
Entry
Lcho_2150         CDS       T00681                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
lch  Leptothrix cholodnii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lcho_2150
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lcho_2150
   00020 Citrate cycle (TCA cycle)
    Lcho_2150
   00620 Pyruvate metabolism
    Lcho_2150
   00640 Propanoate metabolism
    Lcho_2150
   00650 Butanoate metabolism
    Lcho_2150
  Energy metabolism
   00680 Methane metabolism
    Lcho_2150
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Lcho_2150
Enzymes [BR:lch01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Lcho_2150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2350763..2352028
Genome map
AA seq 421 aa AA seqDB search
MLKQIEGSQAVAQAVALCRPEVICAYPISPQTHIVEGLGELVKDGSLAPCEFINVESEFA
AMSVAIGSSAAGARTYTATASQGLLFMAEAVYNASGLGLPIVMTVANRAIGAPINIWNDH
SDSMSQRDCGWIQLFAESNQEALDLHIQAFKLAEELSMPVMVCMDGFILTHAYERVDMPD
QAAVDAFLPPYEPRQVLDPAEPVSIGAMVGPEAFMEVRYLAHAKQLMALDVIPRIADEFE
QRFGRRSHGMSGGLVRGYRTEDADTIVVALGSVLGTLKDTVDEMRAEGLKIGVLGIQSFR
PFPLVAVRAALQGAQRVVVLEKSFSVGLGGVVSTDVRLALSGLQLHGYTVVAGLGGRSIT
KASLHRTLREAIADKLAPLTFMDLDWRIVNRQLEREAQMRRSGPIAENLLRDVGTVASKV
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagcagattgaaggctcgcaggcggtggcgcaggcggtggcgctgtgccgcccg
gaggtgatctgcgcctatccgatctcgccgcagacgcacatcgtcgagggcctgggcgag
ctggtgaaggacggctcgctcgcaccctgcgagttcatcaacgtcgagagcgagttcgcg
gcgatgagcgtggccatcggcagttcggccgccggtgcacgcacctacaccgccaccgcc
agccagggcctgctgttcatggccgaggcggtctacaacgccagcggcctggggctgccg
atcgtgatgacggtggccaaccgggcgatcggcgcgccgatcaacatctggaacgaccac
agcgacagcatgagccagcgcgactgcggctggatccagctgtttgccgagagcaaccag
gaggcgctcgacctgcacatccaggccttcaagctggccgaggaactctcgatgccggtg
atggtgtgcatggacggcttcatcctcacgcacgcctatgagcgcgtcgacatgcccgat
caggccgcggtcgacgccttcctgcctccgtacgaaccgcgccaggtgctcgacccggcc
gagccggtgtcgatcggcgcgatggtcgggcccgaagcgttcatggaggtgcgttacctc
gcgcacgccaagcagctgatggcgctggacgtgatcccgcgcatcgccgatgaattcgag
caacggttcggtcgccgttcccatggcatgtccggcggactggtgcgcggctaccgcacc
gaagacgccgacaccatcgtggtcgcgctcggttcggtgctcggcacgctgaaggacacc
gtagacgagatgcgcgccgagggtctgaagatcggcgtgcttggcatccagtcgttccgg
ccgtttccgctcgttgcggtgcgtgcggcactgcaaggtgcgcagcgggtggtggtgctg
gaaaagagcttctcggttggcctgggcggcgtggtgtcgaccgacgtgcggctcgcgctc
tctgggctgcaactgcacggctacaccgtggtggccgggctcggtgggcgatcgatcacc
aaggcctcgctgcaccgcacgctgcgcgaggcgattgccgacaagcttgcgccgttgacg
ttcatggatctggattggcggatcgtgaatcggcagttggagcgcgaggcgcagatgcgg
cgcagcgggccgatcgcggagaacctgctgcgcgatgtcggcacggtggcgtcgaaggtg
agctga

DBGET integrated database retrieval system