KEGG   Leptothrix cholodnii: Lcho_2151Help
Entry
Lcho_2151         CDS       T00681                                 

Definition
(GenBank) thiamine pyrophosphate protein domain protein TPP-binding
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
lch  Leptothrix cholodnii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lcho_2151
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lcho_2151
   00020 Citrate cycle (TCA cycle)
    Lcho_2151
   00620 Pyruvate metabolism
    Lcho_2151
   00640 Propanoate metabolism
    Lcho_2151
   00650 Butanoate metabolism
    Lcho_2151
  Energy metabolism
   00680 Methane metabolism
    Lcho_2151
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Lcho_2151
Enzymes [BR:lch01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Lcho_2151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2352365..2353396
Genome map
AA seq 343 aa AA seqDB search
MSQQPIKFYQTGTFTVGNRLLAPEQRSVQASTERSNSLNSGHRACQGCGEALGARYAVDA
AMRATDGQLIAANATGCLEVFSTPYPETSWQLPWIHSLFGNAAAVGTGIAAALKVKAQKL
AKTAGQARSDVRVIAQGGDGGTTDIGFGCLSGMFERNDDVLYICYDNEAYMNTGVQRSSA
TPPAARTATTMAVGAHPGAEFGQGKNLPLIAMAHEIPYVATATVADLRDLEAKVAHAMSL
HGARYLHILVPCPLGWGSASHDTIKLARLARETGLFPVFEAEHGEVTHVTKIRNRVPVED
YLRPQKRFAHLFGTPGQPQMLARIQADADRNIRRFKLLDEVTA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagcaaccgatcaagttctaccagaccggcacgttcaccgtcggtaaccgcctg
ctcgcccccgagcaacgcagcgtgcaagccagcaccgagcgcagcaactccctcaactcc
ggccaccgcgcctgccagggctgcggcgaggcgctgggagcgcgttatgcggtcgatgcc
gcgatgcgtgccaccgacggccagctgatcgccgccaacgccaccggctgcctggaggtg
ttctccacgccctaccccgaaacctcatggcagctgccgtggatccactcgctgttcggc
aatgccgcggcagtgggcaccggcatcgcggcggcgttgaaggtcaaggcgcaaaaattg
gcaaagacagccggccaggcccgcagcgacgtgcgcgtgatcgcccagggtggcgacggc
ggcaccaccgacatcggcttcggttgcctgagcggcatgttcgagcgcaacgacgacgtg
ctctacatctgctacgacaacgaggcctacatgaacaccggcgtgcagcgcagctcggcc
acgccgccggcggcccgcacggccaccacgatggcagtgggcgcgcaccccggcgccgag
ttcggccagggcaagaacctgccgctgatcgcgatggcgcacgagatcccgtacgtggcc
accgccaccgtcgccgacctgcgtgacctggaggccaaggtggctcacgcgatgagcctg
cacggcgcgcgctacctgcacatcctggtgccctgcccgctcggctggggctcggccagt
cacgacaccatcaagctcgcccggctggcgcgcgagaccggcctcttcccggtcttcgag
gccgagcatggcgaggtgacccacgtgacaaagatccgcaaccgcgtgccggtcgaggat
tacctgcggccgcagaaacgcttcgcccacctcttcggcacgcccgggcagccgcagatg
ctggcgcggatccaggccgatgcggatcgcaacatccgccgcttcaagctgctcgacgag
gtgacggcatga

DBGET integrated database retrieval system