KEGG   Leptothrix cholodnii: Lcho_2437Help
Entry
Lcho_2437         CDS       T00681                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
lch  Leptothrix cholodnii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2646474..2647127
Genome map
AA seq 217 aa AA seqDB search
MNVEQARFNMIEQQIRPWDVLDSSVLSLLAVVKREDFVPAAHRSVAFMDLEVPLPGGQSM
LAPRLEARLLQDLAPHRHEKVLEIGTGSGFMAALLAHKAQQVVSLETRPELVAMARENLR
HAKIMNAEVRQADGSDAKAVAGPWDAIVLSGSVAEVPAALLQQLKVGGRLVAVVGQAPMM
RATRVTRTGERDFRTEVLFDTVAPRLDGFGEPSRFSF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtcgaacaggcccgcttcaacatgatcgagcagcagatccgcccctgggatgtg
ctggacagctcggtgctgtcgctgctggcggtggtcaagcgcgaagatttcgtgcccgcc
gcacaccgcagcgtcgccttcatggacctggaggtgccgctgcccggcggccagtccatg
ctcgccccgcgcctcgaggcccgcctgctgcaggacctcgccccgcaccgccacgagaag
gtgcttgagatcggcaccggctcgggcttcatggccgcgctgctggcgcacaaggcgcag
caggtcgtcagcctcgagacccgccccgagctggtcgcgatggcacgcgagaacctgcgc
cacgccaagatcatgaacgccgaggtgcgccaggccgacggctccgatgccaaggccgtc
gccggtccgtgggacgccatcgtgctgtcgggctcggtggccgaagtgcccgccgcgctg
ctgcagcaactcaaggtcggtggccggctggtcgccgtggtcggccaggccccgatgatg
cgggccacccgcgtcacccgcaccggcgagcgcgatttccgcaccgaggtgctgttcgac
accgtcgcgccccggctcgacggtttcggcgaaccctcgcgtttctcgttctga

DBGET integrated database retrieval system