KEGG   Leptothrix cholodnii: Lcho_2497Help
Entry
Lcho_2497         CDS       T00681                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
lch  Leptothrix cholodnii
Pathway
lch00240  Pyrimidine metabolism
lch01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Lcho_2497
Enzymes [BR:lch01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Lcho_2497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYNP_C Glycos_trans_3N Glycos_transf_3 Biotin_lipoyl_2 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: ACB34762
JGI: Lcho2497
UniProt: B1Y6C6
Position
complement(2718370..2719899)
Genome map
AA seq 509 aa AA seqDB search
MNPPDLRIRRVAIDTWRENVAYLHRDCPVVRASGFQALSKVTVHANGTTISAVLNVVDDE
RIVQACELGLSEDAFARMNVPEGHAAHVAPAEPPASIGALHRKIGGERLSRDDLHAIVRD
IAQARYSKIELAAFVVATNGYDLDRDEVLHLTEAMIAAGRRLDWQHQVRGGPVVDKHCIG
GIPGNRTSMLVVPIVTAHGMLCPKTSSRAITSPAGTADTMEVLAEVELPFERLTQIVRDT
NGCLVWGGRAGLSPADDILISVERPLAIDSPGQMVASILSKKIAAGSTHLVLDIPVGPTA
KVRSMPAAQQLRKLFEYVADRLGLHLEVVITDGSQPIGSGIGPVLEARDVMRVLRNDPAA
PADLRDKSLRLAGRVIEFDPDVRGGDGWRIARDILESGRALAQMNALIDAQGRRLQPPAL
GEMTHEVIAPADGAVSAIDNLQLARIARLAGAPQVIGAGVDLLRKQGDAVQAGQPLYRIH
ACYAADLGFSRDLAARDSGYTVAATTRPS
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgcctgacctgcgcatccgccgcgtcgccatcgacacctggcgcgagaacgtc
gcctacctgcaccgcgactgcccggtggtgcgggcctcgggtttccaggcgctgtcgaag
gtgacggtgcacgccaacggcaccaccatcagcgcggtgctcaacgtggtcgacgacgag
cgcatcgtgcaggcctgcgagctgggcctgtccgaagacgccttcgcacgcatgaacgtg
cccgagggtcacgccgcccatgtggcgccggccgagccgcctgcctcgatcggcgcgctg
caccgcaagatcggcggcgagcggctgtcgcgcgacgacctgcacgcgatcgtgcgcgac
atcgcccaggcgcgttattccaagatcgagctggccgccttcgtggtcgccaccaacggc
tacgacctcgaccgcgacgaggtgctgcacctcaccgaggccatgatcgccgccggccgc
cggctcgactggcagcaccaggtgcgcggcgggccggtggtcgacaagcactgcatcggc
ggcatcccgggcaaccgcacctcgatgctggtggtgccgatcgtcacggcgcacggcatg
ctgtgccccaagacctcgtcgcgcgccatcacctcgccggccggcaccgccgacacgatg
gaggtgctggccgaggtcgagctgcccttcgagcggctgacgcagatcgtgcgcgacacc
aacggctgcctggtgtggggtggccgcgccgggctgtcgccggccgacgacatcctgatc
tcggtcgagcggccgctggcgatcgactcgcccggccagatggtggcctcgatcctgtcc
aagaagatcgccgccggctcgacccacctggtgctcgacatccccgtcggcccgaccgcc
aaggtgcgctcgatgccggccgcgcagcagctgcgcaagctgttcgagtacgtcgccgac
cggctcggcctgcacctcgaggtggtgatcaccgacggcagccagccgatcggcagcggc
atcggcccggtgctggaggcgcgcgacgtgatgcgcgtgctgcgcaacgacccggcggcg
ccggccgacctgcgcgacaagtcgctgcgcctggccggccgcgtgatcgagttcgacccc
gacgtgcgcggcggcgacggctggcgcatcgcccgcgacatcctcgaatcgggccgtgcg
ctggcgcagatgaacgccctgatcgacgcccagggccgccgcctgcagccgcccgcgctc
ggcgagatgacgcacgaggtgatcgcgccggccgacggcgcggtcagcgcgatcgacaac
ctgcagctcgcccgcatcgcccgcctggccggcgccccgcaggtgatcggcgccggcgtc
gacctgttgcgcaagcagggcgatgcggtgcaggccggccagccgctctaccgcatccac
gcctgctacgccgccgacctggggttctcgcgcgacttggccgcgcgcgacagcggctac
accgtcgccgccaccacccgcccgtcatga

DBGET integrated database retrieval system