KEGG   Leptothrix cholodnii: Lcho_2497Help
Entry
Lcho_2497         CDS       T00681                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
lch  Leptothrix cholodnii
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Lcho_2497
Enzymes [BR:lch01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Lcho_2497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2718370..2719899)
Genome map
AA seq 509 aa AA seqDB search
MNPPDLRIRRVAIDTWRENVAYLHRDCPVVRASGFQALSKVTVHANGTTISAVLNVVDDE
RIVQACELGLSEDAFARMNVPEGHAAHVAPAEPPASIGALHRKIGGERLSRDDLHAIVRD
IAQARYSKIELAAFVVATNGYDLDRDEVLHLTEAMIAAGRRLDWQHQVRGGPVVDKHCIG
GIPGNRTSMLVVPIVTAHGMLCPKTSSRAITSPAGTADTMEVLAEVELPFERLTQIVRDT
NGCLVWGGRAGLSPADDILISVERPLAIDSPGQMVASILSKKIAAGSTHLVLDIPVGPTA
KVRSMPAAQQLRKLFEYVADRLGLHLEVVITDGSQPIGSGIGPVLEARDVMRVLRNDPAA
PADLRDKSLRLAGRVIEFDPDVRGGDGWRIARDILESGRALAQMNALIDAQGRRLQPPAL
GEMTHEVIAPADGAVSAIDNLQLARIARLAGAPQVIGAGVDLLRKQGDAVQAGQPLYRIH
ACYAADLGFSRDLAARDSGYTVAATTRPS
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgcctgacctgcgcatccgccgcgtcgccatcgacacctggcgcgagaacgtc
gcctacctgcaccgcgactgcccggtggtgcgggcctcgggtttccaggcgctgtcgaag
gtgacggtgcacgccaacggcaccaccatcagcgcggtgctcaacgtggtcgacgacgag
cgcatcgtgcaggcctgcgagctgggcctgtccgaagacgccttcgcacgcatgaacgtg
cccgagggtcacgccgcccatgtggcgccggccgagccgcctgcctcgatcggcgcgctg
caccgcaagatcggcggcgagcggctgtcgcgcgacgacctgcacgcgatcgtgcgcgac
atcgcccaggcgcgttattccaagatcgagctggccgccttcgtggtcgccaccaacggc
tacgacctcgaccgcgacgaggtgctgcacctcaccgaggccatgatcgccgccggccgc
cggctcgactggcagcaccaggtgcgcggcgggccggtggtcgacaagcactgcatcggc
ggcatcccgggcaaccgcacctcgatgctggtggtgccgatcgtcacggcgcacggcatg
ctgtgccccaagacctcgtcgcgcgccatcacctcgccggccggcaccgccgacacgatg
gaggtgctggccgaggtcgagctgcccttcgagcggctgacgcagatcgtgcgcgacacc
aacggctgcctggtgtggggtggccgcgccgggctgtcgccggccgacgacatcctgatc
tcggtcgagcggccgctggcgatcgactcgcccggccagatggtggcctcgatcctgtcc
aagaagatcgccgccggctcgacccacctggtgctcgacatccccgtcggcccgaccgcc
aaggtgcgctcgatgccggccgcgcagcagctgcgcaagctgttcgagtacgtcgccgac
cggctcggcctgcacctcgaggtggtgatcaccgacggcagccagccgatcggcagcggc
atcggcccggtgctggaggcgcgcgacgtgatgcgcgtgctgcgcaacgacccggcggcg
ccggccgacctgcgcgacaagtcgctgcgcctggccggccgcgtgatcgagttcgacccc
gacgtgcgcggcggcgacggctggcgcatcgcccgcgacatcctcgaatcgggccgtgcg
ctggcgcagatgaacgccctgatcgacgcccagggccgccgcctgcagccgcccgcgctc
ggcgagatgacgcacgaggtgatcgcgccggccgacggcgcggtcagcgcgatcgacaac
ctgcagctcgcccgcatcgcccgcctggccggcgccccgcaggtgatcggcgccggcgtc
gacctgttgcgcaagcagggcgatgcggtgcaggccggccagccgctctaccgcatccac
gcctgctacgccgccgacctggggttctcgcgcgacttggccgcgcgcgacagcggctac
accgtcgccgccaccacccgcccgtcatga

DBGET integrated database retrieval system