KEGG   Leptothrix cholodnii: Lcho_2705Help
Entry
Lcho_2705         CDS       T00681                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
lch  Leptothrix cholodnii
Pathway
lch00020  Citrate cycle (TCA cycle)
lch00190  Oxidative phosphorylation
lch00650  Butanoate metabolism
lch01100  Metabolic pathways
lch01110  Biosynthesis of secondary metabolites
lch01120  Microbial metabolism in diverse environments
lch01130  Biosynthesis of antibiotics
lch01200  Carbon metabolism
Module
lch_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lch_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lch_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Lcho_2705
   00650 Butanoate metabolism
    Lcho_2705
  Energy metabolism
   00190 Oxidative phosphorylation
    Lcho_2705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C MgtC CybS TcpE
Motif
Other DBs
NCBI-ProteinID: ACB34970
JGI: Lcho2705
UniProt: B1Y8A0
Position
complement(2976507..2976869)
Genome map
AA seq 120 aa AA seqDB search
MSQNYGSKRIVVGAHYGLRDWLAQRVTAVLMALFTVALLLQVLFGGPIGYERWSGIFSQQ
WMKVLTFVLIISLAWHAWVGMRDIWMDYIKPVGLRLSLQVFTLVWLVGTAGWAIQVLWRL
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagaactacggatccaagcgcatcgtcgtcggtgcgcactacggccttcgcgac
tggctggcccagcgtgtcaccgccgtgctgatggcgctgttcaccgtggccctgctgctg
caggtgctgttcggcggccccatcggctacgagcgctggtcaggcatcttctcgcagcag
tggatgaaggtgctgaccttcgtgctgatcatctctctcgcctggcacgcctgggtgggc
atgcgtgacatctggatggactacatcaagcccgtcggtctgcggctgtcgctgcaggtg
ttcacgctcgtgtggctcgtcggcactgccggctgggcgatccaagttctctggagactc
tga

DBGET integrated database retrieval system