KEGG   Leptothrix cholodnii: Lcho_2716Help
Entry
Lcho_2716         CDS       T00681                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
lch  Leptothrix cholodnii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2989534..2991444)
Genome map
AA seq 636 aa AA seqDB search
MERTREAGAVTGAGAAAAGAGPGAGAGASASLAKAALRRLAMAKLEPTPANYARAWREEG
GEGIGEAAAEPAGAVARAAVQGIVTRLLPAGAARDRLSQALQSQRWQEVASVVEAEAPSA
AQQAQAWAEVIERSSRCLERGSRTWPVGRRKDSIKHVLSSCRSDPQRLQQRLQSLVASWD
SDAAPVDADAEPSADGAAGEAPVQAEAAGDPLAQAEQALTQAISGVAAGGGPLSAPSGQP
GAWPQVVHLLEASLQAALPPGESRSGEVGGKLQRAASAVREARHEPADIAELQSACDDVR
RVLQHRHHLVDQLGALVNELTDGLGELAEDDSWVEGQCLAMREQLGMGLSSRGVSAVSEL
LGTTRARQQQLRRERAQARDALKHLIHRMLQDIGELGAHTGRFNESVGRYAEVIGSADSL
EGLAGVVREMVDETRTVHMLVSQTTQRLHDEHERARTMADRVVELEAELRQLSQEVCTDQ
LTQIANRRGLLRCFDAERARVERESADLAIGLLDIDNFKRLNDSLGHQTGDEALKFLARR
VGEALRPTDTLARYGGEEFVVLLPGTPSDEAQRVLTRVQRLLSAELFMYEGKQSFVTFSA
GVTLYRPSEAIEVALQRADEALYEAKRTGKNRTCVA
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggaacgaaccagggaagcgggcgcagtgacgggtgcgggagcggcggctgccggtgcc
ggtcccggtgcgggggccggcgcgagtgcgtcgctcgccaaggcggccttgcgccgtctc
gcgatggccaagctcgagcccacgccggccaattacgcgcgtgcgtggcgcgaagaaggc
ggcgagggcatcggtgaggccgctgccgaaccggccggcgccgtcgcacgggcggcggtg
cagggcatcgtgacgcgcttgctgccggccggcgcggcgcgcgaccgcctgagccaggcc
ctgcaatcgcagcgctggcaggaggtcgccagcgtcgtcgaggccgaggcgcccagcgcc
gcgcagcaggcccaggcctgggccgaggtgatcgagcgcagcagccgctgcctcgagcgg
ggctcgcgcacctggccggtggggcgccgcaaggacagcatcaagcacgtgctcagttcc
tgccgcagcgatccgcagcggctgcagcagcggctgcagagtctggtcgccagctgggac
agcgacgcggcgccggtcgatgccgacgccgaaccgtctgccgatggcgcggccggcgaa
gcgcccgtgcaggcggaggcggccggtgatccgctggcgcaggccgagcaggcgttgacg
caggcgatcagcggtgtcgcggccggcggcgggccgctgtccgcaccgagcgggcagccg
ggcgcatggccgcaggtcgtgcacctgctcgaagcgtcgctgcaggctgccttgccaccg
ggcgagagccgctccggcgaggtcggcggcaagctgcagcgcgcggccagcgcggtgaga
gaggcccgtcacgagccggccgacatcgccgaactgcagagcgcctgcgacgacgtgcgg
cgcgtcctgcagcaccgccaccacctcgtcgaccagctcggtgcgctggtcaacgagctg
actgacgggctcggtgaactggccgaggacgacagctgggtcgaaggccagtgcctggcg
atgcgcgaacagctcggcatgggcctgagcagccgcggcgtcagcgccgtcagcgaactg
ctcggcaccacccgcgcgcgccagcagcagttgcgccgcgagcgggcgcaggcgcgtgac
gcgctcaagcacctgatccaccgcatgctgcaggacatcggcgaactcggtgcccacacc
ggccgcttcaacgaaagcgtgggccgctacgccgaggtgatcggctcggccgattcgctc
gagggcctggccggcgtggtgcgcgagatggtcgacgagacccgcacggtgcacatgctg
gtcagccagaccacgcagcgcctgcacgatgaacacgaacgggcgcgcacgatggccgac
cgggtggtcgagctcgaggccgagctgcgccagctgtcgcaggaggtctgcaccgaccag
ctcacgcagatcgccaaccggcgcggcctgctgcgctgcttcgacgccgagcgtgcacgg
gtcgagcgcgagtccgccgacctggcgatcgggctgctcgacatcgacaacttcaagcgc
ctgaacgacagcctgggtcaccagaccggcgacgaggcgctgaagttcctggcccgccgg
gtcggcgaggccctgcggccgaccgacacgctggcgcgctacggcggcgaggagttcgtg
gtgctgctgccgggcacaccgtccgacgaggcgcagcgggtgctgacgcgggtgcagcgg
ctgctgtcggccgagctgttcatgtacgagggcaagcagagcttcgtgaccttctcggcc
ggcgtgacgctgtaccggccgagcgaggcgatcgaggtggcgctgcagcgcgccgacgag
gcgctctacgaggccaagcgcacgggcaagaaccggacctgcgtggcctga

DBGET integrated database retrieval system