KEGG   Leptothrix cholodnii: Lcho_2883Help
Entry
Lcho_2883         CDS       T00681                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lch  Leptothrix cholodnii
Pathway
lch00020  Citrate cycle (TCA cycle)
lch00310  Lysine degradation
lch01100  Metabolic pathways
lch01110  Biosynthesis of secondary metabolites
lch01120  Microbial metabolism in diverse environments
lch01130  Biosynthesis of antibiotics
lch01200  Carbon metabolism
Module
lch_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lch_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Lcho_2883
  Amino acid metabolism
   00310 Lysine degradation
    Lcho_2883
Enzymes [BR:lch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Lcho_2883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ACB35148
JGI: Lcho2883
UniProt: B1XYA3
Position
complement(3173344..3174585)
Genome map
AA seq 413 aa AA seqDB search
MAIVEVKVPQLSESVAEATMLTWKKKPGEAVAIDEILIEIETDKVVLEVPAPAAGVLVAH
VVGDGGTVVSDQLIAQIDTEGKAGAVAAAAAAAAPAAAAAAPAAAANKGDVAMPAAAKIL
AEKGLSATDVAGSGKDGRVTKGDALAAGAKPAAAPIVVAAAPAVAKPLPAVAAPVAQNLG
DRSEQRVPMSRLRARVAERLLQSQSTNAILTTFNEVNMAPVMEMRKKFQDKFEKEHGVKL
GFMSFFVKAAVAALKKYPVLNASVDGNDIVYHGYFDIGIAVGSPRGLVVPIIRNADQLSF
ADIEKTIAGFGQKAKDGKLSMEELTGGTFSISNGGTFGSMLSTPIINPPQSAILGVHATK
DRAVVENGQVVVRPINYLAMSYDHRIIDGREAVLGLVTMKDALEDPARLLFDI
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgttgaagtcaaagtcccccagttgtccgagtcggtcgcagaagcgacgatg
ctgacgtggaagaagaagcccggtgaagccgtggccatcgatgagatcctgatcgagatc
gagaccgacaaggtcgtgctcgaagtgcccgcgccggccgccggcgtgctggtcgcccac
gtggtgggtgacggcggcacggtggtcagcgaccagctgatcgcgcagatcgacaccgaa
ggcaaggccggcgctgtcgctgccgccgctgcggctgccgcccccgccgccgctgccgct
gctccggctgccgccgccaacaagggcgacgtggctatgcccgccgccgccaagatcctg
gccgagaagggcctgtcggccaccgacgtggccggctccggcaaggacggtcgcgtgacc
aagggtgatgccctggccgccggcgccaagcccgccgccgcgccgatcgtggtcgctgca
gcaccggccgttgccaagccgctgcccgccgttgccgcgccggtcgcacagaacctgggt
gaccgctcggaacagcgcgtgccgatgagccgcctgcgcgcccgcgtcgccgagcgcctg
ctgcagtcgcaatcgaccaacgccatcctgaccacgttcaacgaagtgaacatggcgccg
gtgatggagatgcgcaagaagttccaggacaagttcgagaaggaacacggcgtcaagctc
ggtttcatgagcttcttcgtcaaggccgcggtcgccgcgctgaagaagtacccggtgctc
aacgcctcggtcgacggtaacgacatcgtttaccacggctacttcgacatcggcatcgcg
gtgggttcgccgcgtggcctggtggtgccgatcatccgcaacgccgaccagctgagcttt
gccgacatcgagaagactatcgccggcttcggccagaaggccaaggacggcaagctgtcg
atggaagaactgaccggcggcaccttctcgatctccaacggcggtaccttcggctcgatg
ctgtcgaccccgatcatcaacccgccgcagtcggccatcctgggcgtgcacgccaccaag
gaccgcgccgtggtcgagaacggccaggtggtcgtgcgtccgatcaactacctcgccatg
tcgtatgaccaccgcatcatcgacggccgcgaagccgtgctgggcctggtgacgatgaag
gacgccctggaagacccggcgcgcctgctgttcgacatctga

DBGET integrated database retrieval system