KEGG   Leptothrix cholodnii: Lcho_3191Help
Entry
Lcho_3191         CDS       T00681                                 

Definition
cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
lch  Leptothrix cholodnii
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Lcho_3191
Enzymes [BR:lch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Lcho_3191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3529754..3531355
Genome map
AA seq 533 aa AA seqDB search
MNKTDFDAVIIGSGFGGAVSACRLAQAGQKVLVLERGRRWTPANFPREPGDRWLWNQEHP
ELLNGWADLRTFSDMWVAAGAGVGGGSLIYASVSVEAKPQVFEQGWPSGLRYPALKPYYD
RVAKMLDIQELPDNQLNPRYHLMKEAAEACGWGDRFHKVPVAVKFDPRYDASLPDARDDR
HAQWAINPQGRRQGTCVHCGNCDIGCQVQAKNTLDLNYLAEAENHGAEIRPLHLVMGIEA
LDGADGQQGWRVRFDQIDDHQRTPGSVTAKRVILAAGSIGSTELLLRCRDQHKTLPKLSQ
RLGKGWAFNGDFVTPTFYKGRKVSPSHGPTISSAIDLLDGKVDGAPLFIEDGGVPNLAGQ
FIRQRIRNPGWGKLRGLWKALGKVSDADDPLDCMMPWFGQAIDAADGELYLGRLWYAPWK
KVLKMNWQYQRSEAVVDAMVKVHKQLSAATGGSAFIPPTWTVLHNLITPHPLGGCNMADR
AEQGVVDGHGQVFGYQGLYVMDGATIPRAIGLNPSRTIAALAERNVERMLAQA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagacagacttcgacgccgtcatcatcggcagcggtttcgggggtgcggtcagc
gcctgccgcctggcgcaggccggccagaaggtgctggtgctcgaacgcggccggcgctgg
acacccgccaacttcccgcgcgaacccggcgaccgctggctctggaaccaggagcacccc
gagctgctcaacggctgggccgacctgcgcaccttctccgacatgtgggtcgctgcgggc
gccggggtcggcggcggctcgctgatctacgccagcgtgtcggtcgaggccaagccgcag
gtgttcgagcagggctggcccagcggcctgcgctaccccgcgctcaagccgtattacgac
cgcgtggccaagatgctcgacatccaggagctgcccgacaaccagctcaacccgcgctac
cacctgatgaaggaagccgccgaggcctgcggctggggcgatcgtttccacaaggtgccg
gtggcggtgaagttcgacccgcgctacgacgccagcctgcccgacgcgcgcgacgaccgc
catgcgcagtgggccatcaacccgcagggccgccgccagggcacctgcgtgcactgcggc
aactgcgacatcggctgccaggtgcaggccaagaacacgctcgacctcaactacctggcc
gaggccgagaaccacggcgccgagatccgcccgctgcacctggtgatgggcatcgaggcg
ctcgacggcgccgacggccagcagggctggcgcgtcaggttcgaccagatcgacgaccac
cagcgcacgcccggcagcgtgacggccaagcgcgtgatcctggcggccggctcgatcggc
agcaccgagctgctgctgcgctgccgcgaccagcacaagacgctgcccaagctgtcgcag
cggctcggcaagggctgggccttcaacggcgacttcgtcacgcccaccttctacaagggc
cgcaaggtctcgcccagccacggcccgaccatcagctcggcgatcgacctgctcgacggc
aaggtcgacggcgcaccgctgttcatcgaggacggcggcgtgccgaacctggccggccag
ttcatccgccagcgcatccggaaccccggctggggcaagctgcgcgggctctggaaggcg
ctcggcaaggtcagcgatgccgacgatccgctcgattgcatgatgccgtggttcggccag
gcgatcgatgccgccgacggcgagctctacctcggccggctctggtacgcgccctggaag
aaggtgctgaagatgaactggcagtaccagcgctccgaggcggtggtcgacgcgatggtc
aaggtgcacaagcagctctcggccgcgaccggcggcagcgccttcatcccgcccacctgg
acggtgctgcacaacctcatcacgccgcacccgctgggcggctgcaacatggccgaccgc
gccgagcagggtgtcgtcgacggccacggccaggtgttcggctaccaggggctgtacgtg
atggacggcgccaccatcccgcgtgcgatcgggctcaacccctcgcgcaccatcgccgct
ctggccgagcgcaacgtcgagcgcatgctggcccaggcctga

DBGET integrated database retrieval system