KEGG   Leptothrix cholodnii: Lcho_3223Help
Entry
Lcho_3223         CDS       T00681                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lch  Leptothrix cholodnii
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Lcho_3223
Enzymes [BR:lch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Lcho_3223
Exosome [BR:lch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Lcho_3223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3573317..3574810
Genome map
AA seq 497 aa AA seqDB search
MSFLLALDQGTSSSRSIVFDIEGRPVAMAQRELRQIYPQPGWVEHDPIEIRDSQLATARE
AIARAGISAHDIRAVGITNQRETTLLWNRRTGAPLHNAIVWQDRRTEPICAALRERGAEA
LVRQRTGLLIDPYFSGTKLQWLLDHVPGAREQAARGELAFGTVDAWLVWQLTGGRVHATD
VTNASRTLLFDVHANRWDDELLSLLDVPHELLPAVFPSSHLYGETDAGLLGAALPIAGIA
GDQQSALFGQACFKPGLAKNTYGTGCFLLMHNGDRFQSSANGLVTTAAAQTGPQPQFAIE
GSVFVGGAVVQWLRDGLRAIDSASAVQALAQSVPDSGGVVFVPAFTGLGAPYWKPDARGA
IVGLSRGTTLGHIARAALESIAYQSAALLAAMGRDAQACGGAAVTELRVDGGACVNDLLM
QFQADLLGVPVVRPQVIETTARGAAFLAGLSTGVYRGLDELEALWQPERTFHPTLPPGRA
SELMAQWEHAVRQTVAS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgagctttcttctggccctcgaccagggcacgtcgagttcgcgcagcatcgtcttcgac
atcgagggccgtccggtcgcgatggcgcagcgcgagctgcggcagatctatccgcagccc
ggctgggtcgaacacgatccgatcgagatccgcgacagccagctcgccaccgcacgcgag
gcgatcgcgcgcgccggcatctcggcgcacgacatccgcgccgtcggcatcaccaaccag
cgcgagaccaccctgctgtggaaccgccgcaccggcgcgccgctgcacaacgcgatcgtc
tggcaggaccgccgcaccgagccgatctgcgcggcgctgcgcgagcgcggcgccgaggcg
ctggtgcgccagcgcaccggcctgctgatcgacccctatttctccggcaccaagctccag
tggctgctcgaccacgtgcccggcgcacgcgagcaggccgcacgtggcgaactcgccttc
ggcacggtcgacgcgtggctggtctggcagctgaccggcgggcgggtgcacgccaccgac
gtgaccaacgcctcgcgcacgctgctgttcgacgtgcacgccaaccgctgggacgacgag
ctgctgagcctgctcgacgtgccgcacgagctgctgcctgccgtgtttccgtcgtcgcat
ctctacggcgagaccgatgccggcctgctcggcgcggccttgccgatcgccggcatcgcc
ggcgaccagcagagcgcgctgttcggccaggcctgcttcaagcccggcctggccaagaac
acctacggcaccggctgcttcctgctgatgcacaacggcgatcgtttccagtcctcggcc
aacggcctggtgaccaccgccgcagcgcagaccgggccgcagccgcagttcgcgatcgaa
ggcagcgtcttcgtcggcggcgcggtggtgcagtggctgcgcgacggcctgcgcgcgatc
gattcggcctcggcggtgcaggcactggcgcagagcgtgcccgactcgggcggcgtggtc
ttcgtgccggcattcaccgggctgggggcgccctactggaaacctgacgcacgcggcgcc
atcgtcggcctgtcgcgtggcacgacgctcggccacatcgcccgcgccgcgctggagagc
atcgcctaccagagcgccgccctgctggccgcgatgggtcgcgacgcccaggcctgcggc
ggcgcggccgtcaccgagctgcgcgtggacggcggcgcctgcgtcaacgacctgctgatg
cagttccaggccgacctgctgggcgtgccggtggtgcgaccccaggtgatcgagaccacc
gcgcgcggcgccgccttcctggccggcctgagcaccggcgtgtaccgcggcctcgacgaa
ctcgaagccctgtggcagcccgagcgcaccttccacccgaccctacccccagggcgcgcc
agcgagctgatggcgcagtgggaacacgccgtgcgccagaccgtggcgagctga

  All links  
No link information was found.   
DBGET integrated database retrieval system