KEGG   Leptothrix cholodnii: Lcho_3239Help
Entry
Lcho_3239         CDS       T00681                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
lch  Leptothrix cholodnii
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Lcho_3239
  Lipid metabolism
   00561 Glycerolipid metabolism
    Lcho_3239
   00600 Sphingolipid metabolism
    Lcho_3239
Enzymes [BR:lch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Lcho_3239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3591795..3593219)
Genome map
AA seq 474 aa AA seqDB search
MRDASPRRLKITLIGAGSTVFTRNLLGDMLSHPELAGAEIALHDIDEHRLRLSEKVAYRI
ADAVGAKPVITASTDRRRALDGARFVLNTIQVGGYKPATVTDFDIPKKYGLEQTIGDTLG
IGGIMRGLRTIPVQLAMLRDMDELCAPGAVHLNYVNPMAMITWALNRASTRVPTVGLCHS
VQHTAQELANDLGLPVDEIQYHCAGINHMSFYLRFERNGEDLYPKLRDIQREGRMPAWNR
VRYEMLRQLGHFPTESSEHFAEYVPWFIKQGREELLRKFNIPLDEYPGRCQVFEHAWPYI
ERELEVPGSQDPAALLAQLRAADIHVMQREIEGAPQMLEGLRSVKRSVEYGSAIIHSIVT
GQPRVINGNVLNHQLIDNLPQGCAIEVPCLVDHNGVQPTRVGKLPVHLAALMRTNVNVQE
MVVESVLEQRRDHVYHAAMLDPHTAATLDLDQIRAMVDELLAAHRPFLPEYLHG
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgatgcctccccgcgccgactgaagatcaccctgatcggtgccggcagcaccgtc
ttcacccgcaacctgctgggtgacatgctcagccatcccgagctcgcgggcgccgagatc
gcgctgcacgacatcgacgaacaccgcctgcggctgtccgaaaaggtggcctaccgcatc
gccgacgcggtgggcgccaagccggtgatcaccgccagcaccgaccgccgccgcgcgctc
gacggcgcgcgcttcgtgctcaacaccatccaggtcggcggctacaagccggccaccgtg
accgacttcgacatccccaagaaatacggcctcgaacagaccatcggcgacacgctgggc
atcggcggcatcatgcgcggcctgcgcacgatccccgtgcagttggcgatgctgcgcgac
atggacgagctgtgcgcgcccggcgccgtgcacctcaactacgtcaacccgatggcgatg
atcacgtgggcgctcaaccgcgcctcgacgcgcgtgcccaccgtcggcctgtgccacagc
gtgcagcacaccgcgcaggagctggccaacgacttggggctgccggtcgacgagatccag
taccactgcgccggcatcaaccacatgtcgttctacctgcgcttcgagcgcaacggcgag
gacctgtaccccaagctgcgcgacatccagcgcgagggccgcatgccggcctggaaccgc
gtgcgctacgagatgctgcgtcagctggggcactttccgaccgagtcgagcgagcacttt
gccgagtacgtgccgtggttcatcaagcagggccgcgaggagctgctgcgcaagttcaac
atcccgctcgacgagtacccgggccgctgccaggtgttcgaacacgcctggccctacatc
gagcgtgagctcgaagtgcccggctcgcaggatccggccgcgctgctggcgcagctgcgc
gccgccgacatccacgtcatgcagcgcgagatcgaaggcgcgccgcagatgctcgaaggc
ctgcgctcggtcaagcgcagcgtcgaatacggcagcgcgatcatccattcgatcgtgacc
ggccagccgcgcgtgatcaacggcaacgtgctcaaccaccagctgatcgacaacctgccg
caaggctgtgcgatcgaggtgccgtgcctggtcgaccacaacggcgtgcagcccacgcgc
gtgggcaaactgcccgtgcacttggcggcgctgatgcgcaccaacgtcaacgtgcaggag
atggtggtggagtcggtgctcgaacagcggcgcgaccacgtctaccatgcggcgatgctc
gacccgcacaccgccgccacgctcgatctggatcagatccgcgcgatggtcgacgagctg
ctggcggcgcaccggcccttcctgcccgagtacctgcacggctga

DBGET integrated database retrieval system