KEGG   Leptothrix cholodnii: Lcho_3245Help
Entry
Lcho_3245         CDS       T00681                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
lch  Leptothrix cholodnii
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:lch00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Lcho_3245
Enzymes [BR:lch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Lcho_3245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3599372..3601393
Genome map
AA seq 673 aa AA seqDB search
MQLGVCYYPEHWPPSGWADDAQRMRAMGISWVRIAEFAWSRIEPSPGVFDWAWLDEAIET
LHAQGLKVVMCTPTATPPKWLVDTMPDMLAIDAHGQPRGFGSRRHYCFSHAGYRAESRRI
SRAVAERYGQHPAVAAWQTDNEYGCHDTVLSYSAAAKAGFRRWLQARYGDIAALNTAWGT
VFWSMEYRSFDQIDAPVGTVTEAHPAHRLDWRRFASDEVRAFNREQVEILRELSPARPVS
HNFMGFFTEFDHHDVAADLDIATWDSYPLGFTQNFFLSADEKARYARVGHPDIPGFHHDL
YRGMCASTRADAPAHGRWWVMEQQPGPVNWASWNTAPHDGMVRLWSWQAFAHGAEVVSYF
RWRQAPFAQEQMHTGLHRPDRSVDQGGVEAAQVGAELQALSTQMDLNAQGIVNRVALVFD
YDSLWMAQIQPQGADYNPLELQFRVYSALRQLGLDVDIVSPNAALAGYALIVLPVQLHAS
AALVKALTQAAAAGAQIVLGPRAGAKTEVLAIPENLAPGALSALAGVQVLRVASLPPGVQ
AVIRFEGDAGSVATAQRWREDLALTGAQAEALFDDDGRAAVTRLGSLRYVAGWLDADGWR
QLLMRAATDAGLSPQPLPADLRVSRIGGLLLACNFSDRTLAYTPTSTPSSSSAAPLLGSA
TLAPRGIALWHLN
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgcaactgggcgtctgctactaccccgaacactggccgccatccgggtgggccgatgac
gcgcagcgcatgcgcgcgatgggcatcagctgggtgcgcatcgccgagttcgcctggagc
cgcatcgaaccgtcgccgggcgtgttcgactgggcctggctcgatgaagcgatcgagacg
ctgcacgcgcagggcctgaaggtcgtgatgtgcacgcccaccgccacgccgccgaagtgg
ctggtggacacgatgccggacatgctcgcgatcgacgcccacggccaaccgcgcggcttc
ggctcgcgccggcattactgcttctcgcacgccggctaccgggccgagtcgcgccgcatc
agtcgcgcagtggccgaacgctacggtcaacacccagccgtggccgcctggcagaccgac
aacgaatacggctgccacgacacggtgttgagttattcggccgccgccaaggccggtttc
cgccgctggctgcaggcgcgttacggcgacatcgccgcgctcaacacggcctggggcacg
gtgttctggagcatggaataccgctcgttcgatcagatcgacgcgccggtcggcaccgtc
accgaggcgcatccggcgcaccggctcgactggcgccgcttcgcctccgacgaggtgcga
gccttcaaccgcgagcaggtcgagatcctgcgcgagctgtcgcctgctcggccggtgtcg
cacaacttcatgggcttcttcaccgagttcgaccaccacgacgtggccgccgatctcgac
atcgccacctgggacagctacccgctcggcttcacgcagaacttcttcctctcggccgac
gagaaggcgcgttacgcccgcgtcggccacccggacatcccgggctttcaccacgacctg
tatcgcggcatgtgcgccagcacgcgcgccgatgcgcctgcccacggccgctggtgggtg
atggagcagcagcccggcccggtcaactgggcgagctggaacaccgcgccgcatgacggc
atggtgcggctgtggagctggcaggcgttcgcgcacggcgcagaggtggtgagctacttc
cgctggcgccaggcgccgtttgcgcaggagcagatgcacaccggcttgcaccggccggac
cgcagtgtcgaccagggcggcgtcgaagccgcacaggtcggcgccgagttgcaggcgctg
tccacgcagatggatttgaacgcgcaaggcatcgtcaaccgcgtcgcgctggtgttcgac
tacgacagcttgtggatggcgcagatccagccgcagggcgccgactacaacccgctggag
ctgcagttccgcgtctacagcgcgctgcgccagctggggctggatgtcgacatcgtgagc
ccgaacgccgcgctggccggctacgcgctgatcgtgctgccggtgcagttgcatgcgtca
gccgcgctggtgaaggcgctcacgcaagccgcagcagccggcgcgcagatcgtgctcggc
ccacgtgccggcgccaagaccgaggtgctggcgatacccgagaacctcgcgcccggcgcc
ttgagcgcgctggccggcgtgcaggtgctgcgggtggcatcgctgccgccgggcgtgcag
gcggtgatccgcttcgagggcgatgcaggttcagtcgccacggcccagcgctggcgcgag
gacctcgcgctgacgggcgcgcaggccgaggcgctgttcgacgacgacggccgcgccgcc
gtcacgcgactgggcagcttgcgctacgtcgccggctggctcgacgccgacggctggcgg
caacttctgatgcgcgcggccaccgacgccggcctgtcgccgcagccgctgcccgccgac
ctgcgcgtcagccgcatcggcggcctgctgctggcctgcaacttctcggatcgcacgctg
gcctacacgccgacgtcgacgccctcgtcctcttcggccgcgcccctgctgggctcggca
acgctcgcgccgcggggcatcgccctgtggcacctgaactga

DBGET integrated database retrieval system